Comparing BWI76_RS00250 FitnessBrowser__Koxy:BWI76_RS00250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
12asA Asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp (see paper)
89% identity, 99% coverage: 4:330/330 of query aligns to 1:327/327 of 12asA
11asA Asparagine synthetase mutant c51a, c315a complexed with l-asparagine (see paper)
89% identity, 99% coverage: 4:330/330 of query aligns to 1:327/327 of 11asA
>BWI76_RS00250 FitnessBrowser__Koxy:BWI76_RS00250
MKTAYIAKQRQISFVKSHFSRQLEEKLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVK
TLPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLTAIHSVYVDQWDWE
RVMGDEERHCGTLKATVEAIYAGIKATEDAVSKEFGLTPFLPETIHFVHSQELLSRYPDL
DAKGRERAIAKELGAVFLIGIGGKLSDGQRHDVRAPDYDDWSTPAAEGYAGLNGDILVWN
PVLEDAFELSSMGIRVDAEALKRQLAMTGDEDRLKLEWHQALLRGEMPQTIGGGIGQSRL
TMLLLQLDHIGQVQCGVWPTQVRQSVAALL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory