Comparing BWI76_RS00275 BWI76_RS00275 ribose ABC transporter ATP-binding protein RbsA to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
95% identity, 100% coverage: 1:501/501 of query aligns to 1:501/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 44% coverage: 4:222/501 of query aligns to 4:231/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 44% coverage: 4:222/501 of query aligns to 4:231/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 44% coverage: 3:222/501 of query aligns to 1:217/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 44% coverage: 4:222/501 of query aligns to 3:218/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 44% coverage: 4:222/501 of query aligns to 3:218/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 44% coverage: 4:222/501 of query aligns to 3:218/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 44% coverage: 4:222/501 of query aligns to 3:218/242 of 2oljA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 44% coverage: 1:220/501 of query aligns to 1:222/648 of P75831
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
26% identity, 44% coverage: 3:222/501 of query aligns to 1:217/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
26% identity, 44% coverage: 3:222/501 of query aligns to 1:217/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
26% identity, 44% coverage: 3:222/501 of query aligns to 1:217/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
26% identity, 44% coverage: 3:222/501 of query aligns to 1:217/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
26% identity, 44% coverage: 3:222/501 of query aligns to 1:217/238 of 6s8gA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
26% identity, 44% coverage: 3:222/501 of query aligns to 1:217/233 of 6b8bA
6mbnA Lptb e163q in complex with atp (see paper)
25% identity, 44% coverage: 3:222/501 of query aligns to 2:218/241 of 6mbnA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
25% identity, 44% coverage: 3:222/501 of query aligns to 1:217/240 of 6mjpA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
29% identity, 52% coverage: 2:264/501 of query aligns to 2:255/650 of 5ws4A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 45% coverage: 4:226/501 of query aligns to 1:226/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 42% coverage: 12:222/501 of query aligns to 9:217/240 of 4ymuJ
>BWI76_RS00275 BWI76_RS00275 ribose ABC transporter ATP-binding protein RbsA
MEALLQLKGIDKAFPGVKALSGASLNVYPGRVMALVGENGAGKSTMMKVLTGIYARDAGS
LLWLGKETTFNGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFVNRFGKIDWKTMYA
EADKLLAKLNLRFNSQKLVGDLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESL
FRVIRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAEREVASLDEDLLIEMMVGR
KLEDQYPRLDKAPGAVRLKVDNLCGSGVENISFILRQGEILGVAGLMGAGRTELMKVLYG
ALPRSSGSVTLDGREVVARSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFS
RGGGSLKHKDEQQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILD
EPTRGVDVGAKKEIYQLINQFKAEGLSIILVSSEMPEVLGMSDRIMVMHEGHLGGEFTRE
QATQEVLMAAAVGKLNRVNQE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory