Comparing BWI76_RS00285 FitnessBrowser__Koxy:BWI76_RS00285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
92% identity, 92% coverage: 26:296/296 of query aligns to 1:271/271 of 1dbpA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
74% identity, 91% coverage: 26:293/296 of query aligns to 2:268/270 of 4zjpA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
58% identity, 91% coverage: 28:296/296 of query aligns to 2:271/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
46% identity, 92% coverage: 25:295/296 of query aligns to 6:276/284 of 7e7mC
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
40% identity, 92% coverage: 26:296/296 of query aligns to 1:281/292 of 2fn8A
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
35% identity, 82% coverage: 36:279/296 of query aligns to 18:269/296 of 4irxA
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
33% identity, 85% coverage: 27:278/296 of query aligns to 3:256/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
33% identity, 85% coverage: 27:278/296 of query aligns to 3:256/287 of 4ry0A
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
33% identity, 89% coverage: 30:293/296 of query aligns to 5:281/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
33% identity, 89% coverage: 30:293/296 of query aligns to 5:281/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
33% identity, 89% coverage: 30:293/296 of query aligns to 5:281/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
33% identity, 89% coverage: 30:293/296 of query aligns to 5:281/288 of 1gudA
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
32% identity, 81% coverage: 23:262/296 of query aligns to 1:245/291 of 4rxmA
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
32% identity, 80% coverage: 27:262/296 of query aligns to 3:243/288 of 4rxmB
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
31% identity, 88% coverage: 26:284/296 of query aligns to 2:270/287 of 5dteB
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
32% identity, 89% coverage: 29:290/296 of query aligns to 9:274/287 of 4yo7A
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
33% identity, 82% coverage: 40:281/296 of query aligns to 14:263/302 of 5ocpA
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
30% identity, 85% coverage: 29:280/296 of query aligns to 5:267/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
30% identity, 85% coverage: 29:280/296 of query aligns to 5:267/297 of 4ry9A
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
33% identity, 74% coverage: 48:266/296 of query aligns to 45:274/318 of P39325
Sites not aligning to the query:
>BWI76_RS00285 FitnessBrowser__Koxy:BWI76_RS00285
MNMKKLATLVSAVALSATVSANAMAKDTIALVISTLNNPFFVSLKEGAQKEADKLGYNLV
VLDSQNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKLANQAKIPVITLDRQASKG
DVVSHIASDNVLGGKMAGDYIAKKVGENAKIIELQGIAGTSAARERGEGFQQAVAAHKFN
VLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKSDVMVVGFD
GTPDGEKAVNSGKLAATIAQLPEQIGVKGVETADKVLKGEKVETSYPLELKLVIKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory