SitesBLAST
Comparing BWI76_RS00290 FitnessBrowser__Koxy:BWI76_RS00290 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
83% identity, 100% coverage: 1:308/309 of query aligns to 1:308/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
83% identity, 99% coverage: 2:308/309 of query aligns to 1:307/307 of 1gqtB
- active site: A251 (= A252), A252 (= A253), G253 (= G254), D254 (= D255)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N187), T222 (= T223), G224 (= G225), S225 (= S226), A252 (= A253), G253 (= G254), H278 (= H279), A281 (= A282)
- binding cesium ion: D248 (= D249), I250 (= I251), A284 (= A285), R287 (= R288), S293 (= S294)
- binding alpha-D-ribofuranose: N13 (= N14), D15 (= D16), G41 (= G42), N45 (= N46), E142 (= E143), D254 (= D255)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
84% identity, 99% coverage: 4:308/309 of query aligns to 1:305/305 of 1rk2A
- active site: A249 (= A252), A250 (= A253), G251 (= G254), D252 (= D255)
- binding adenosine-5'-diphosphate: T220 (= T223), G222 (= G225), S223 (= S226), A250 (= A253), G251 (= G254), H276 (= H279), A279 (= A282)
- binding tetrafluoroaluminate ion: G213 (= G216), R215 (≠ G218)
- binding magnesium ion: D246 (= D249), A282 (= A285), R285 (= R288), S291 (= S294)
- binding alpha-D-ribofuranose: N11 (= N14), D13 (= D16), G38 (= G41), G39 (= G42), K40 (= K43), N43 (= N46), E140 (= E143), D252 (= D255)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
58% identity, 98% coverage: 6:308/309 of query aligns to 3:305/306 of 4xckA
- active site: A249 (= A252), A250 (= A253), G251 (= G254), D252 (= D255)
- binding adenosine-5'-diphosphate: T220 (= T223), G222 (= G225), S223 (= S226), V242 (= V245), T247 (= T250), A250 (= A253), F254 (= F257), H276 (= H279), A279 (= A282), V283 (= V286)
- binding alpha-D-ribofuranose: N11 (= N14), D13 (= D16), G39 (= G42), K40 (= K43), N43 (= N46), A95 (= A98), I107 (= I110), I109 (= I112), E140 (= E143), T248 (≠ I251), D252 (= D255)
8cqxA Ribokinase from t.Sp mutant a92g
42% identity, 97% coverage: 7:305/309 of query aligns to 2:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N187), T217 (= T223), G219 (= G225), A220 (≠ S226), G222 (= G228), F250 (= F257), N272 (≠ H279), G275 (≠ A282), A276 (= A283), T279 (≠ V286)
- binding magnesium ion: D242 (= D249), T244 (≠ I251), A278 (= A285), S287 (= S294)
2fv7A Crystal structure of human ribokinase
38% identity, 95% coverage: 7:301/309 of query aligns to 4:303/308 of 2fv7A
- active site: G252 (≠ A252), A253 (= A253), G254 (= G254), D255 (= D255)
- binding adenosine-5'-diphosphate: N185 (= N187), T221 (= T223), G223 (= G225), G226 (= G228), T242 (≠ G242), V245 (= V245), A253 (= A253), G254 (= G254), N281 (≠ H279), A284 (= A282), A285 (= A283), V288 (= V286)
5c3yA Structure of human ribokinase crystallized with amppnp
38% identity, 95% coverage: 7:301/309 of query aligns to 4:303/306 of 5c3yA
- active site: G252 (≠ A252), A253 (= A253), G254 (= G254), D255 (= D255)
- binding amp phosphoramidate: T221 (= T223), G223 (= G225), V245 (= V245), T250 (= T250), G254 (= G254), N281 (≠ H279), A284 (= A282), A285 (= A283)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
38% identity, 95% coverage: 7:301/309 of query aligns to 5:304/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N187), T222 (= T223), G224 (= G225), A225 (≠ S226), G227 (= G228), T243 (≠ G242), V246 (= V245), A254 (= A253), G255 (= G254), N282 (≠ H279), A285 (= A282), A286 (= A283), V289 (= V286)
- binding alpha-D-ribofuranose: D14 (= D16), G40 (= G42), K41 (= K43), N44 (= N46), A96 (= A98), E141 (= E143), D256 (= D255)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
38% identity, 95% coverage: 7:301/309 of query aligns to 5:304/317 of 5c41A
- active site: G253 (≠ A252), A254 (= A253), G255 (= G254), D256 (= D255)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N187), T222 (= T223), G224 (= G225), A225 (≠ S226), G227 (= G228), V246 (= V245), G255 (= G254), N282 (≠ H279), A285 (= A282), A286 (= A283)
6wjzA Crystal structure of human ribokinase in complex with ampcp
38% identity, 95% coverage: 7:301/309 of query aligns to 5:304/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N187), T222 (= T223), G224 (= G225), A225 (≠ S226), G227 (= G228), T243 (≠ G242), V246 (= V245), A254 (= A253), G255 (= G254), N282 (≠ H279), A285 (= A282), A286 (= A283), V289 (= V286)
6znxC Ribokinase from thermus species
39% identity, 97% coverage: 7:305/309 of query aligns to 2:263/265 of 6znxC
5byfA Crystal structure of human ribokinase in complex with amp
38% identity, 94% coverage: 11:301/309 of query aligns to 10:305/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
38% identity, 94% coverage: 11:301/309 of query aligns to 22:317/322 of Q9H477
6a8cA Ribokinase from leishmania donovani with adp (see paper)
38% identity, 96% coverage: 4:301/309 of query aligns to 13:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G225), A246 (≠ S226), T271 (= T250), A274 (= A253), G275 (= G254), N300 (≠ H279), A303 (= A282)
- binding glycerol: D25 (= D16), S42 (≠ G33), S44 (≠ H35), G50 (= G41), G51 (= G42), N55 (= N46)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
38% identity, 96% coverage: 4:301/309 of query aligns to 13:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G225), A246 (≠ S226), T271 (= T250), A274 (= A253), G275 (= G254), N300 (≠ H279), A303 (= A282), V307 (= V286)
- binding glycerol: D25 (= D16), G50 (= G41), G51 (= G42), N55 (= N46), N157 (≠ L142), I159 (≠ S144), E190 (= E176)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
38% identity, 96% coverage: 4:301/309 of query aligns to 13:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N187), T243 (= T223), G245 (= G225), A246 (≠ S226), G248 (= G228), T271 (= T250), G273 (≠ A252), A274 (= A253), G275 (= G254), N300 (≠ H279), A303 (= A282), V307 (= V286)
- binding glycerol: D25 (= D16), G50 (= G41), G51 (= G42), N55 (= N46)
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
36% identity, 98% coverage: 4:306/309 of query aligns to 2:310/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N187), K225 (≠ T223), G227 (= G225), I246 (≠ G242), A248 (≠ K244), A257 (= A253), G258 (= G254), F261 (= F257), A286 (= A282), S287 (≠ A283)
- binding alpha-D-ribofuranose: N12 (= N14), D14 (= D16), G40 (= G42), K41 (= K43), N44 (= N46), E144 (= E143), D259 (= D255)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 98% coverage: 4:306/309 of query aligns to 68:376/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
34% identity, 98% coverage: 3:305/309 of query aligns to 2:320/320 of 6xk2A
3i3yD Crystal structure of ribokinase in complex with d-ribose from klebsiella pneumoniae
28% identity, 97% coverage: 6:305/309 of query aligns to 2:284/285 of 3i3yD
Query Sequence
>BWI76_RS00290 FitnessBrowser__Koxy:BWI76_RS00290
MKTAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGANQAVAAGRSGANISF
IACTGDDDIGERVRRQLESDNIDVAPVRAVAGESTGVALIFVNAEGENTIGIHAGANAAL
CVAQVDAEKERIASAQALLMQLESPLESVLAAAKIAHQNQTSVILNPAPARELPDELLTL
VDIITPNETEAEKLTGVRVENDEDAAKAAKVLHDKGIGTVIITLGSRGVWASSEGNGRRV
PGFKVQAVDTIAAGDTFNGALVTALLEGRELAEAIRFAHAAAAIAVTRKGAQPSVPWRKE
IDEFLRQQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory