SitesBLAST
Comparing BWI76_RS00545 FitnessBrowser__Koxy:BWI76_RS00545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
38% identity, 100% coverage: 1:279/280 of query aligns to 1:279/285 of 3q94A
- active site: D85 (= D83), H86 (= H84), E145 (= E143), H181 (= H181), H209 (= H209), N231 (= N231)
- binding zinc ion: H86 (= H84), E114 (= E112), H163 (≠ R163), H181 (= H181), H209 (= H209), E235 (= E235), E239 (≠ Q239)
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
37% identity, 100% coverage: 1:279/280 of query aligns to 1:279/285 of P13243
- T212 (= T212) modified: Phosphothreonine
- T234 (= T234) modified: Phosphothreonine
1rv8B Class ii fructose-1,6-bisphosphate aldolase from thermus aquaticus in complex with cobalt (see paper)
37% identity, 97% coverage: 9:279/280 of query aligns to 8:299/305 of 1rv8B
- active site: D80 (= D83), H81 (= H84), E140 (= E143), H178 (= H181), H208 (= H209), N251 (= N231)
- binding cobalt (ii) ion: H81 (= H84), E132 (= E135), H178 (= H181), H208 (= H209)
- binding sulfate ion: R116 (= R119), H123 (≠ R126), S211 (≠ T212), D253 (≠ G233), T254 (= T234)
8q59A Crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) (see paper)
36% identity, 100% coverage: 1:279/280 of query aligns to 1:270/280 of 8q59A
- binding (3~{S},4~{S})-2,3,4-tris(oxidanyl)-5-oxidanylidene-6-phosphonooxy-hexane-1-sulfonic acid: G50 (≠ S51), Q51 (≠ T52), K52 (≠ G53), D82 (= D83), H83 (= H84), H172 (= H181), G173 (= G182), H200 (= H209), G201 (= G210), S203 (≠ T212), N222 (= N231), D224 (≠ G233), T225 (= T234)
- binding zinc ion: H83 (= H84), H172 (= H181), H200 (= H209)
3n9sA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate, a competitive inhibitor (see paper)
35% identity, 98% coverage: 7:279/280 of query aligns to 6:301/307 of 3n9sA
- active site: C69 (≠ A71), E70 (= E72), G136 (= G137), H180 (= H181), A226 (vs. gap), N253 (= N231)
- binding calcium ion: D104 (= D105), S106 (= S107), E134 (= E135)
- binding 4-{hydroxy[(phosphonooxy)acetyl]amino}butyl dihydrogen phosphate: N23 (= N25), S49 (= S51), D82 (= D83), H83 (= H84), H180 (= H181), G181 (= G182), K184 (vs. gap), H210 (= H209), G211 (= G210), S213 (≠ T212), N253 (= N231), D255 (≠ G233), T256 (= T234)
- binding zinc ion: H83 (= H84), H180 (= H181), H210 (= H209)
8q5aA Crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) (see paper)
38% identity, 93% coverage: 20:279/280 of query aligns to 19:270/276 of 8q5aA
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
35% identity, 99% coverage: 3:279/280 of query aligns to 2:271/279 of 4to8A
P0AB74 D-tagatose-1,6-bisphosphate aldolase subunit KbaY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Ketose 1,6-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 from Escherichia coli (strain K12) (see paper)
35% identity, 99% coverage: 1:276/280 of query aligns to 1:275/286 of P0AB74
- D82 (= D83) active site, Proton donor
- H83 (= H84) binding
- H180 (= H181) binding
- H208 (= H209) binding
3c52A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
34% identity, 98% coverage: 7:279/280 of query aligns to 6:290/296 of 3c52A
- active site: C69 (≠ A71), E70 (= E72), G136 (= G137), H169 (= H181), A215 (vs. gap), N242 (= N231)
- binding calcium ion: D104 (= D105), S106 (= S107), E134 (= E135)
- binding phosphoglycolohydroxamic acid: D82 (= D83), H83 (= H84), H169 (= H181), K173 (vs. gap), H199 (= H209), G200 (= G210), S202 (≠ T212), N242 (= N231), D244 (≠ G233), T245 (= T234)
- binding zinc ion: H83 (= H84), H169 (= H181), H199 (= H209)
3n9rA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)-phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
34% identity, 98% coverage: 7:279/280 of query aligns to 6:291/297 of 3n9rA
- active site: C69 (≠ A71), E70 (= E72), G136 (= G137), H170 (= H181), A216 (vs. gap), N243 (= N231)
- binding 2-[hydroxy(4-hydroxybutyl)amino]-2-oxoethyl dihydrogen phosphate: H83 (= H84), H170 (= H181), G171 (= G182), K174 (vs. gap), H200 (= H209), G201 (= G210), S203 (≠ T212), N243 (= N231), D245 (≠ G233), T246 (= T234)
- binding zinc ion: H83 (= H84), H170 (= H181), H200 (= H209)
3c56A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor (see paper)
34% identity, 98% coverage: 7:279/280 of query aligns to 6:291/297 of 3c56A
- active site: C69 (≠ A71), E70 (= E72), G136 (= G137), H170 (= H181), A216 (vs. gap), N243 (= N231)
- binding 3-{hydroxy[(phosphonooxy)acetyl]amino}propyl dihydrogen phosphate: N23 (= N25), S49 (= S51), D82 (= D83), H170 (= H181), K174 (vs. gap), G201 (= G210), S203 (≠ T212), N243 (= N231), D245 (≠ G233), T246 (= T234), R249 (≠ N237)
- binding zinc ion: H83 (= H84), H170 (= H181), H200 (= H209)
5ucpA Class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with fbp and cleavage products (see paper)
33% identity, 98% coverage: 7:279/280 of query aligns to 6:286/292 of 5ucpA
- binding 1,6-di-O-phosphono-D-fructose: S49 (= S51), D82 (= D83), H83 (= H84), H165 (= H181), K169 (vs. gap), G196 (= G210), S198 (≠ T212), N238 (= N231), D240 (≠ G233), T241 (= T234), R244 (≠ N237)
- binding zinc ion: H83 (= H84), H83 (= H84), H83 (= H84), E134 (= E135), H165 (= H181), H165 (= H181), H165 (= H181), H195 (= H209), H195 (= H209)
5uckA Class ii fructose-1,6-bisphosphate aldolase of helicobacter pylori with cleavage products (see paper)
33% identity, 98% coverage: 7:279/280 of query aligns to 6:285/291 of 5uckA
- binding glyceraldehyde-3-phosphate: S49 (= S51), D82 (= D83), H83 (= H84), H164 (= H181), D239 (≠ G233), R243 (≠ N237)
- binding zinc ion: H83 (= H84), H83 (= H84), E134 (= E135), H164 (= H181), H194 (= H209), H194 (= H209)
5ud4A Class ii fructose-1,6-bisphosphate aldolase h180q variant of helicobacter pylori with tbp (see paper)
33% identity, 98% coverage: 7:279/280 of query aligns to 6:287/293 of 5ud4A
- binding 1,6-di-O-phosphono-D-tagatose: S49 (= S51), D82 (= D83), Q166 (≠ H181), G167 (= G182), K170 (vs. gap), G197 (= G210), S199 (≠ T212), N239 (= N231), D241 (≠ G233), T242 (= T234), R245 (≠ N237)
- binding zinc ion: H83 (= H84), H83 (= H84), E134 (= E135), H196 (= H209), H196 (= H209)
A8B2U2 Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) (see 4 papers)
33% identity, 100% coverage: 1:279/280 of query aligns to 1:301/323 of A8B2U2
- S50 (= S51) binding
- D83 (= D83) active site, Proton donor; mutation to A: Severe loss of catalytic activity.
- H84 (= H84) binding
- H178 (= H181) binding ; binding
- G179 (= G182) binding
- K182 (≠ T185) binding
- H210 (= H209) binding
- G211 (= G210) binding
- S213 (≠ T212) binding
- N253 (= N231) binding
- D255 (≠ G233) binding ; mutation to A: 9.4-fold reduction in substrate affinity and 50-fold reduction in catalytic affinity. Has some activity towards tagatose-1,6-bisphosphate.
- S256 (≠ T234) binding
- R259 (≠ N237) binding ; mutation to A: 1.8-fold reduction in substrate affinity and 2.8-fold reduction in catalytic efficiency. 6-fold reduction in substrate affinity and 24-fold reduction in catalytic efficiency; when associated with A-278.
- D278 (≠ S256) mutation to A: 159-fold reduction in substrate affinity and 2770-fold reduction in catalytic efficiency. 6-fold reduction in substrate affinity and 24-fold reduction in catalytic efficiency; when associated with A-259.
- R280 (= R258) binding
1gvfB Structure of tagatose-1,6-bisphosphate aldolase (see paper)
33% identity, 98% coverage: 2:276/280 of query aligns to 1:266/275 of 1gvfB
- active site: D81 (= D83), H82 (= H84), H171 (= H181), H199 (= H209), N221 (= N231)
- binding phosphoglycolohydroxamic acid: D81 (= D83), H82 (= H84), H171 (= H181), G172 (= G182), H199 (= H209), G200 (= G210), S202 (≠ T212), N221 (= N231), V222 (= V232), A223 (≠ G233), T224 (= T234)
- binding zinc ion: H82 (= H84), H171 (= H181), H199 (= H209)
5ud0A Class ii fructose-1,6-bisphosphate aldolase e149a variant of helicobacter pylori with cleavage products (see paper)
34% identity, 98% coverage: 7:279/280 of query aligns to 6:276/282 of 5ud0A
3ohiA Structure of giardia fructose-1,6-biphosphate aldolase in complex with 3-hydroxy-2-pyridone (see paper)
33% identity, 96% coverage: 12:279/280 of query aligns to 9:297/319 of 3ohiA
- binding ({3-hydroxy-2-oxo-4-[2-(phosphonooxy)ethyl]pyridin-1(2H)-yl}methyl)phosphonic acid: S49 (= S51), D82 (= D83), H83 (= H84), H174 (= H181), G175 (= G182), K178 (≠ T185), G207 (= G210), S209 (≠ T212), N249 (= N231), D251 (≠ G233), S252 (≠ T234), R255 (≠ N237)
- binding zinc ion: H83 (= H84), H174 (= H181), H206 (= H209)
3gayA Structure of giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate (see paper)
33% identity, 96% coverage: 12:279/280 of query aligns to 9:297/319 of 3gayA
- binding 1,6-di-O-phosphono-D-tagatose: N23 (= N25), S49 (= S51), D82 (= D83), H174 (= H181), G175 (= G182), K178 (≠ T185), H206 (= H209), G207 (= G210), S209 (≠ T212), N249 (= N231), D251 (≠ G233), S252 (≠ T234), R255 (≠ N237)
- binding zinc ion: H83 (= H84), H174 (= H181), H206 (= H209)
3gb6A Structure of giardia fructose-1,6-biphosphate aldolase d83a mutant in complex with fructose-1,6-bisphosphate (see paper)
33% identity, 96% coverage: 12:279/280 of query aligns to 9:296/318 of 3gb6A
- binding 1,6-di-O-phosphono-D-fructose: N23 (= N25), S49 (= S51), H173 (= H181), G174 (= G182), K177 (≠ T185), H205 (= H209), G206 (= G210), S208 (≠ T212), N248 (= N231), D250 (≠ G233), S251 (≠ T234), R254 (≠ N237)
Query Sequence
>BWI76_RS00545 FitnessBrowser__Koxy:BWI76_RS00545
MSLYNFNAILKIAQERNFKAIGSFNLHCIEMLPAFFKAAQQSHSPLMIQISTGTAEYLGY
RLLVDAVRSLAESENVPTCLHLDHCSDISAIETAMDAGFTSVMYDGSHLDLEENIGNTRI
VVEMARPRNITVEGELGAIGGSEDGKAVAAEDICFTTVEDAKRFVEETRVDMLAVSVGTV
HGLYTGKAQIQHQRLKEISAATGVPLVLHGGTGVSDEDMRQAVTEGINKVNVGTEMNVQW
VDRCKTTFEKGKVNDSVRKFLIPANNAVTHVLIEKIALFK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory