Comparing BWI76_RS00585 FitnessBrowser__Koxy:BWI76_RS00585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 72% coverage: 3:223/307 of query aligns to 1:215/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 72% coverage: 3:223/307 of query aligns to 1:215/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 72% coverage: 3:223/307 of query aligns to 1:215/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 72% coverage: 3:223/307 of query aligns to 1:215/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 72% coverage: 3:223/307 of query aligns to 1:215/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 72% coverage: 3:223/307 of query aligns to 1:215/291 of 3pueB
Sites not aligning to the query:
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
29% identity, 69% coverage: 4:216/307 of query aligns to 6:212/297 of 8u8wA
4pfmA Shewanella benthica dhdps with lysine and pyruvate
25% identity, 77% coverage: 4:238/307 of query aligns to 3:234/295 of 4pfmA
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 75% coverage: 5:234/307 of query aligns to 4:234/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 75% coverage: 5:234/307 of query aligns to 4:234/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 75% coverage: 5:234/307 of query aligns to 4:234/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 75% coverage: 5:234/307 of query aligns to 4:234/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 75% coverage: 5:234/307 of query aligns to 4:234/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 75% coverage: 5:234/307 of query aligns to 4:234/298 of 3nevA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
30% identity, 72% coverage: 4:225/307 of query aligns to 2:217/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
30% identity, 72% coverage: 4:225/307 of query aligns to 2:217/292 of 3puoA
Sites not aligning to the query:
3lbcD D-sialic acid aldolase complexed with l-arabinose
27% identity, 75% coverage: 4:234/307 of query aligns to 5:232/296 of 3lbcD
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
27% identity, 75% coverage: 4:234/307 of query aligns to 10:237/302 of 2wpbA
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
27% identity, 75% coverage: 4:234/307 of query aligns to 2:229/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
27% identity, 75% coverage: 4:234/307 of query aligns to 2:229/292 of 1fdyA
>BWI76_RS00585 FitnessBrowser__Koxy:BWI76_RS00585
MKTINGIVPVMLTPFAADERIDYPALAKLIDWYLEKGVDALFAVCQSSEMQFLSLEERVE
LARFVVQRVNGRIPVIASGHISDDIEAQKAELLAMAQTGIDALVLVTNHLDPRNEGSDVF
YAVLNTLLETLPASLPLGLYECPAPYRRLLTDDEFTWCANSGRFVVLKDVSCDLPTVERR
VRLAQGTPLNVINANAAIAWPAILAGSQGFSGVFTNFHPELYSWLWREGKNQRALADELA
IFLSLGAVSETLGYPKNAKIYHQRLGTFDSITCRVNKDDVLNKYWGLTVILDQIRAGTEQ
WRQRIVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory