Comparing BWI76_RS00615 FitnessBrowser__Koxy:BWI76_RS00615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
57% identity, 97% coverage: 1:191/196 of query aligns to 3:193/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
57% identity, 97% coverage: 1:191/196 of query aligns to 2:192/201 of 1krvA
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
57% identity, 97% coverage: 1:191/196 of query aligns to 2:192/201 of 1kruA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
57% identity, 97% coverage: 1:191/196 of query aligns to 2:192/200 of 1krrA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
44% identity, 94% coverage: 1:185/196 of query aligns to 2:186/186 of 4isxA
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
38% identity, 93% coverage: 4:185/196 of query aligns to 6:188/188 of 3igjC
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
33% identity, 94% coverage: 1:185/196 of query aligns to 1:183/183 of 3nz2C
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
35% identity, 95% coverage: 1:186/196 of query aligns to 1:187/190 of 5u2kA
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
34% identity, 83% coverage: 23:185/196 of query aligns to 14:176/176 of 3ectA
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
33% identity, 94% coverage: 1:184/196 of query aligns to 4:185/185 of 3nz2J
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
33% identity, 59% coverage: 68:182/196 of query aligns to 169:279/307 of A1ADJ6
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
29% identity, 62% coverage: 59:180/196 of query aligns to 132:247/272 of 3gvdI
Sites not aligning to the query:
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
43% identity, 38% coverage: 115:188/196 of query aligns to 145:215/216 of P71063
7l82AAA Putative acetyl transferase protein (see paper)
31% identity, 64% coverage: 55:180/196 of query aligns to 108:216/216 of 7l82AAA
Sites not aligning to the query:
7l81AAA Putative acetyl transferase protein (see paper)
31% identity, 64% coverage: 55:180/196 of query aligns to 108:216/216 of 7l81AAA
Sites not aligning to the query:
7l7zAAA Putative acetyl transferase protein (see paper)
31% identity, 64% coverage: 55:180/196 of query aligns to 108:216/216 of 7l7zAAA
Sites not aligning to the query:
7l7yAAA Putative acetyl transferase protein (see paper)
31% identity, 64% coverage: 55:180/196 of query aligns to 108:216/217 of 7l7yAAA
Sites not aligning to the query:
Q93S40 Polysialic acid O-acetyltransferase; Polysialyltransferase; PST; EC 2.3.1.- from Neisseria meningitidis (see paper)
31% identity, 65% coverage: 55:182/196 of query aligns to 67:191/215 of Q93S40
2wlgA Crystallographic analysis of the polysialic acid o- acetyltransferase oatwy (see paper)
31% identity, 65% coverage: 56:182/196 of query aligns to 64:187/211 of 2wlgA
2wleC Crystallographic analysis of the polysialic acid o- acetyltransferase oatwy (see paper)
31% identity, 65% coverage: 56:182/196 of query aligns to 64:187/211 of 2wleC
>BWI76_RS00615 FitnessBrowser__Koxy:BWI76_RS00615
MDMKARMNSGELYLDSGYGLPEQRLMGKARAYEYNHSHPFNQELRDDIIRRMFASVGKAC
WIEPPINIAYGTHTTIGDNFYANFNLTLVDDADIIIGNNVMFAPNVTISTAGHPVHPDLR
HTQQQFSQPVIIEDGVWLGTGVIINPGVTIGKNSVIGAGSVVNRSIPANVVAAGVPCRIL
REISDEDKNKYQLFAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory