Comparing BWI76_RS00660 FitnessBrowser__Koxy:BWI76_RS00660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
43% identity, 98% coverage: 7:497/503 of query aligns to 4:493/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 45% coverage: 6:232/503 of query aligns to 1:223/241 of 4u00A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 47% coverage: 7:243/503 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 44% coverage: 7:227/503 of query aligns to 4:232/254 of 1g6hA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
25% identity, 47% coverage: 4:238/503 of query aligns to 3:232/240 of 1ji0A
2ixfA Crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant) (see paper)
31% identity, 45% coverage: 1:227/503 of query aligns to 3:237/255 of 2ixfA
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 47% coverage: 8:243/503 of query aligns to 12:246/265 of P07821
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 3:229/235 of 6mhzA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 3:229/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 3:229/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 3:229/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 3:229/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 3:229/238 of 6s8gA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 46% coverage: 7:238/503 of query aligns to 2:229/240 of 6mjpA
P36370 Antigen peptide transporter 1; APT1; ATP-binding cassette sub-family B member 2; Peptide transporter TAP1; EC 7.4.2.14 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 45% coverage: 1:227/503 of query aligns to 467:701/725 of P36370
6mbnA Lptb e163q in complex with atp (see paper)
27% identity, 46% coverage: 8:238/503 of query aligns to 4:230/241 of 6mbnA
6bppA E. Coli msba in complex with lps and inhibitor g092 (see paper)
31% identity, 46% coverage: 10:238/503 of query aligns to 341:568/576 of 6bppA
Sites not aligning to the query:
6bplA E. Coli msba in complex with lps and inhibitor g907 (see paper)
31% identity, 46% coverage: 10:238/503 of query aligns to 341:568/576 of 6bplA
Sites not aligning to the query:
7ph3A Amp-pnp bound nanodisc reconstituted msba with nanobodies, spin- labeled at position a60c (see paper)
31% identity, 46% coverage: 10:238/503 of query aligns to 342:569/577 of 7ph3A
7mewA E. Coli msba in complex with g247 (see paper)
31% identity, 46% coverage: 10:238/503 of query aligns to 337:564/572 of 7mewA
Sites not aligning to the query:
>BWI76_RS00660 FitnessBrowser__Koxy:BWI76_RS00660
MSASTPLLSLKGITKVFPGVRALENVQLDLWPGKVTALIGENGAGKSTLVKVMTGIYQPE
EGEILYKAIPIQLPNPESAHKVGITAIHQETVLFDELSVTENIFVGQYLHTGLLKKLDWP
AMHRKASEILTRLEVQIDPRATLKTLSIAQRHMVAIARALSFEAQVVILDEPTAALSQHE
ILEFYQIVERLKQDGKAILFISHKFDEIFELADYYTILRDGVYVSSGAINDITEERMVAM
MVGRAITQTYPKVDCIPGETVLEVKDLCHPTEFAHISFSLRKGEILGFYGLVGAGRTELM
QALSGVSHPSSGDIVLKGKPMRFRQPADAISAGIVCVPEERQKQGAIIALPIAQNISLPQ
LSKLNPGGVLNDAREWRLADEYASRLQVKAFSWRQAVETLSGGNQQKVVIGKWLATHPEV
IILDEPTKGIDIGSKAAVHQFMSELVSQGLAVIMVSSELPEVMGMADRIIVMHEGLMVAE
YRAGEATAETIVSAASGIGQEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory