Comparing BWI76_RS00665 FitnessBrowser__Koxy:BWI76_RS00665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
38% identity, 92% coverage: 27:328/328 of query aligns to 8:321/321 of 4wzzA
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
34% identity, 91% coverage: 25:324/328 of query aligns to 5:314/316 of 1tjyA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
36% identity, 79% coverage: 25:284/328 of query aligns to 3:258/314 of 3t95A
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
31% identity, 92% coverage: 23:325/328 of query aligns to 7:320/321 of 4pz0A
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
32% identity, 92% coverage: 23:324/328 of query aligns to 1:313/315 of 3ejwA
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
29% identity, 81% coverage: 24:289/328 of query aligns to 1:273/326 of 6dspA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
34% identity, 73% coverage: 37:275/328 of query aligns to 19:254/289 of 5hqjA
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
28% identity, 76% coverage: 26:273/328 of query aligns to 4:243/313 of 2h3hA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
25% identity, 79% coverage: 28:285/328 of query aligns to 11:262/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
25% identity, 79% coverage: 28:285/328 of query aligns to 6:257/278 of 6guqA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
28% identity, 76% coverage: 26:273/328 of query aligns to 4:243/305 of 3c6qC
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
27% identity, 71% coverage: 25:258/328 of query aligns to 3:235/292 of 2fn8A
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
27% identity, 79% coverage: 26:285/328 of query aligns to 3:254/274 of 2ioyA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 68% coverage: 25:248/328 of query aligns to 4:229/287 of 5dteB
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
27% identity, 88% coverage: 26:314/328 of query aligns to 5:284/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
27% identity, 88% coverage: 26:314/328 of query aligns to 5:284/287 of 4ry0A
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
23% identity, 80% coverage: 25:285/328 of query aligns to 2:260/276 of 3ksmA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
27% identity, 84% coverage: 20:294/328 of query aligns to 1:273/295 of 4rxtA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
24% identity, 69% coverage: 70:295/328 of query aligns to 52:282/303 of 5dkvA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
23% identity, 76% coverage: 25:272/328 of query aligns to 2:248/290 of 4wutA
>BWI76_RS00665 FitnessBrowser__Koxy:BWI76_RS00665
MKTNTSLILTVAILALSGSALAEVKIALVAKSLGNGFFEAANVGAQEAAKELGDVKVIYT
GPTTTTAEAQIEVLNGLIAQGVDAIAISANDPDAVVPVLKKAMQRGIKVVSWDSGVAPAG
RQIHLNPSNNALIGETNVKLAADALKALNVEKGDVAILSATPTSTNQNIWIEEMKKVLPQ
YPSVNLVTVAYGDDLSDKSYREAVGLLKSYPDLKVIVSPSSVGIVAAAQAVKDQGKIGKV
YVTGLGLPSEMAGAIKSGASKSFAIWNPIDLGYAATYLADDLVKGTATKTEANMGKLGKV
KLDADGSGAMAEPFVYDASNIDKFSKIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory