Comparing BWI76_RS00785 FitnessBrowser__Koxy:BWI76_RS00785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see paper)
96% identity, 100% coverage: 1:385/386 of query aligns to 1:385/386 of P00935
1cs1D Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
96% identity, 99% coverage: 3:385/386 of query aligns to 1:383/384 of 1cs1D
6ld9A Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with cystathionine
59% identity, 98% coverage: 6:383/386 of query aligns to 6:383/387 of 6ld9A
6ld8A Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with aminoacrylate and cysteine
59% identity, 98% coverage: 6:383/386 of query aligns to 6:383/388 of 6ld8A
6lgoA Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with homolanthionine
59% identity, 98% coverage: 6:383/386 of query aligns to 6:383/387 of 6lgoA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
46% identity, 98% coverage: 6:384/386 of query aligns to 5:384/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
46% identity, 97% coverage: 6:380/386 of query aligns to 5:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
46% identity, 97% coverage: 6:380/386 of query aligns to 5:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
46% identity, 97% coverage: 6:380/386 of query aligns to 5:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
46% identity, 97% coverage: 6:380/386 of query aligns to 5:380/381 of 4ixzA
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
46% identity, 92% coverage: 21:376/386 of query aligns to 19:372/377 of 7d7oB
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
46% identity, 96% coverage: 6:376/386 of query aligns to 8:367/377 of 7ba4A
4ixsB Native structure of xometc at ph 5.2 (see paper)
46% identity, 97% coverage: 6:380/386 of query aligns to 4:371/372 of 4ixsB
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
42% identity, 98% coverage: 4:380/386 of query aligns to 2:370/373 of 4l0oH
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
45% identity, 97% coverage: 6:381/386 of query aligns to 6:382/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
45% identity, 97% coverage: 6:381/386 of query aligns to 6:382/382 of 6k1lA
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
42% identity, 97% coverage: 5:380/386 of query aligns to 3:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
42% identity, 97% coverage: 5:380/386 of query aligns to 3:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
42% identity, 97% coverage: 5:380/386 of query aligns to 3:377/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
42% identity, 97% coverage: 5:380/386 of query aligns to 3:377/380 of 7mcqA
>BWI76_RS00785 FitnessBrowser__Koxy:BWI76_RS00785
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAILLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQNDEQALSAALAEKPKLVLVESPSNPLLRVVDIAKICGLAREAGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPATVTELAWWANNIGVTGGAFDSYL
LLRGLRTLSPRMEVAQRNALAIVDYLKTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLSGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory