Comparing BWI76_RS00790 FitnessBrowser__Koxy:BWI76_RS00790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 14:810/810 of query aligns to 91:912/916 of O81852
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 44% coverage: 455:810/810 of query aligns to 2:359/359 of P31116
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
33% identity, 44% coverage: 455:810/810 of query aligns to 1:358/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
33% identity, 44% coverage: 455:810/810 of query aligns to 1:358/358 of 1q7gA
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
33% identity, 44% coverage: 455:810/810 of query aligns to 1:358/358 of 1ebuD
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
33% identity, 44% coverage: 455:810/810 of query aligns to 1:358/358 of 1ebfA
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 40% coverage: 458:783/810 of query aligns to 7:341/376 of O94671
2cdqA Crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s- adenosylmethionine (see paper)
27% identity, 54% coverage: 16:455/810 of query aligns to 8:461/470 of 2cdqA
2j0xA Crystal structure of e. Coli aspartokinase iii in complex with lysine and aspartate (t-state) (see paper)
33% identity, 35% coverage: 14:298/810 of query aligns to 4:287/447 of 2j0xA
Sites not aligning to the query:
2j0wA Crystal structure of e. Coli aspartokinase iii in complex with aspartate and adp (r-state) (see paper)
33% identity, 35% coverage: 14:298/810 of query aligns to 4:287/447 of 2j0wA
P08660 Lysine-sensitive aspartokinase 3; Aspartate kinase III; AKIII; Lysine-sensitive aspartokinase III; EC 2.7.2.4 from Escherichia coli (strain K12) (see paper)
33% identity, 35% coverage: 14:298/810 of query aligns to 6:289/449 of P08660
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
28% identity, 48% coverage: 14:401/810 of query aligns to 3:403/458 of 3c1nA
Sites not aligning to the query:
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
27% identity, 48% coverage: 14:401/810 of query aligns to 3:408/464 of 2hmfA
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
30% identity, 38% coverage: 14:320/810 of query aligns to 3:320/468 of 3c1mC
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 36% coverage: 9:298/810 of query aligns to 12:316/519 of O60163
Sites not aligning to the query:
3tviE Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
22% identity, 54% coverage: 14:452/810 of query aligns to 5:436/439 of 3tviE
P61489 Aspartokinase; Aspartate kinase; AK; ASK; Threonine-sensitive AK; ThrA; EC 2.7.2.4 from Thermus thermophilus (see paper)
29% identity, 33% coverage: 189:452/810 of query aligns to 132:400/405 of P61489
Sites not aligning to the query:
3tviA Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
21% identity, 54% coverage: 16:452/810 of query aligns to 5:428/429 of 3tviA
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
29% identity, 28% coverage: 457:680/810 of query aligns to 1:217/319 of 3ingA
Sites not aligning to the query:
5yeiC Mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase (see paper)
25% identity, 33% coverage: 188:452/810 of query aligns to 130:393/397 of 5yeiC
>BWI76_RS00790 FitnessBrowser__Koxy:BWI76_RS00790
MSVIAQAGAKGRQLHKFGGSSLADAKCYLRVAGIMTEYSQAGDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVQQSLRRYQMDLISGLLSPDAADTLIATFIQDLERLAGLLDGGVTDA
VYAEVVGHGEVWSARLMAAVLNHLGVEAAWLDARSFLRAERSPQPQVDEGLSYPLLQQLM
AQHPNKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGASRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPGGQDFKLAHKELDAILKRAQLRPLAVGVHADRKLL
QFCYTSEVADSALKLLDEAGLPGELRLRQKLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRAGPTESLIQGLHQSLFRAEKRIGLVLFGKGNIGSRWLELFARE
QTTLSARTGFEFILAGVVDSRRSLLNYEGLDASRALAFFNDEAIEQDEESLFLWMRAHPY
DDLVVLDVTASAQLADQYLDFASHGFHVISANKLAGASSSSKYRQIHDAFEKTGRHWLYN
ATVGAGLPVNHTVRDLIDSGDTILALSGIFSGTLSWLFLQFDGTVPFTDLVDQAWQQGLT
EPDPRVDLSGKDVMRKLVILAREAGYDIEPDQVRVESLVPAHCEEGSVDHFFENGEALND
QMLQRLEAAREMGLVLRYVARFDANGKARVGVEAVREEHPLAALLPCDNVFAIESRWYRD
NPLVIRGPGAGRDVTAGAIQSDINRLAQLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory