Comparing BWI76_RS00845 FitnessBrowser__Koxy:BWI76_RS00845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
35% identity, 98% coverage: 6:333/334 of query aligns to 6:335/342 of 2ozpA
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
35% identity, 98% coverage: 6:333/334 of query aligns to 8:337/344 of O50146
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
35% identity, 98% coverage: 6:333/334 of query aligns to 8:337/344 of 5einA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
36% identity, 98% coverage: 6:333/334 of query aligns to 9:340/347 of 2i3gA
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
36% identity, 98% coverage: 6:333/334 of query aligns to 6:337/344 of 7npjB
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
36% identity, 98% coverage: 6:333/334 of query aligns to 6:337/344 of 7nphC
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
36% identity, 98% coverage: 6:333/334 of query aligns to 6:337/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
36% identity, 98% coverage: 6:333/334 of query aligns to 6:337/344 of 7nnrA
1ys4A Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii (see paper)
25% identity, 94% coverage: 6:318/334 of query aligns to 7:337/348 of 1ys4A
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
25% identity, 94% coverage: 6:318/334 of query aligns to 13:343/354 of Q57658
3hskA Crystal structure of aspartate semialdehyde dehydrogenase with NADP from candida albicans (see paper)
27% identity, 55% coverage: 6:188/334 of query aligns to 7:190/358 of 3hskA
>BWI76_RS00845 FitnessBrowser__Koxy:BWI76_RS00845
MLNTLIVGASGYAGAELVAYVNRHPHMTITALTVSAQSNDAGKLVSDLHPQLKGIVDLPL
QPMSDISEFSAGVDVVFLATAHEVSHDLAPQFLAAGCVVFDLSGAFRVNDGAFYEKYYGF
THQHPELLEQAVYGLAEWSVEKLKEANLIAVPGCYPTAAQLSLKPLIDAGLLDLNQWPVI
NATSGVSGAGRKASIGNSFCEVSLQPYGVFNHRHHPEISTHLGADVIFTPHLGNFKRGIL
ETITCRLKPGVSKEQVAAVFQQAYADKPLVRLYDKGVPALKNVVGLPFCDIGFAVQDEHI
IVVAAEDNLLKGAAAQAVQCANIRFGFAETQSLI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory