Comparing BWI76_RS00850 FitnessBrowser__Koxy:BWI76_RS00850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x2wA Acetylglutamate kinase from escherichia coli bound to n-acetyl-l- glutamyl-5-phosphate (see paper)
94% identity, 100% coverage: 1:257/257 of query aligns to 2:258/258 of 2x2wA
1oh9A Acetylglutamate kinase from escherichia coli complexed with mgadp, n- acetyl-l-glutamate and the transition-state mimic alf4- (see paper)
94% identity, 100% coverage: 1:257/257 of query aligns to 2:258/258 of 1oh9A
1gs5A N-acetyl-l-glutamate kinase from escherichia coli complexed with its substrate n-acetylglutamate and its substrate analog amppnp (see paper)
94% identity, 100% coverage: 1:257/257 of query aligns to 2:258/258 of 1gs5A
P0A6C8 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Escherichia coli (strain K12) (see 4 papers)
94% identity, 100% coverage: 1:257/257 of query aligns to 2:258/258 of P0A6C8
Sites not aligning to the query:
3t7bB Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
85% identity, 99% coverage: 1:255/257 of query aligns to 2:256/258 of 3t7bB
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
35% identity, 86% coverage: 4:225/257 of query aligns to 24:246/282 of 2btyA
Sites not aligning to the query:
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 86% coverage: 4:225/257 of query aligns to 24:246/282 of Q9X2A4
Sites not aligning to the query:
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
34% identity, 86% coverage: 4:225/257 of query aligns to 29:255/292 of 2bufA
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
32% identity, 86% coverage: 4:225/257 of query aligns to 30:264/301 of Q9HTN2
Sites not aligning to the query:
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
32% identity, 86% coverage: 4:225/257 of query aligns to 29:263/298 of 2bufC
Q9SCL7 Acetylglutamate kinase, chloroplastic; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; AtNAGK; EC 2.7.2.8 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
35% identity, 90% coverage: 4:235/257 of query aligns to 88:321/347 of Q9SCL7
Sites not aligning to the query:
4usjB N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii (see paper)
35% identity, 90% coverage: 4:235/257 of query aligns to 22:255/281 of 4usjB
Sites not aligning to the query:
2rd5B Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana (see paper)
35% identity, 90% coverage: 4:235/257 of query aligns to 24:257/283 of 2rd5B
Sites not aligning to the query:
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
33% identity, 98% coverage: 4:256/257 of query aligns to 25:282/289 of 2v5hB
2bufK Arginine feed-back inhibitable acetylglutamate kinase (see paper)
33% identity, 86% coverage: 4:225/257 of query aligns to 29:240/273 of 2bufK
3l86A The crystal structure of smu.665 from streptococcus mutans ua159
33% identity, 84% coverage: 4:220/257 of query aligns to 5:219/245 of 3l86A
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
30% identity, 86% coverage: 4:223/257 of query aligns to 26:253/289 of 7nloA
Sites not aligning to the query:
7nlyA Crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole.
30% identity, 86% coverage: 4:223/257 of query aligns to 30:257/293 of 7nlyA
7nlpA Crystal structure of mycobacterium tuberculosis argb in complex with l-canavanine
30% identity, 86% coverage: 4:223/257 of query aligns to 29:256/292 of 7nlpA
Sites not aligning to the query:
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
30% identity, 86% coverage: 4:223/257 of query aligns to 28:255/291 of 7nnbA
>BWI76_RS00850 FitnessBrowser__Koxy:BWI76_RS00850
MNPLIIKLGGVLLDSEEALERLFTALVNYRESHQRPLIIVHGGGCVVDELMKQLNLPVNK
KNGLRVTPADQIDIITGALAGTANKTLLAWAKKHGLAAVGLFLGDGDSVKVTQLDEELGH
VGFAQPGSPALINTLLAGGYMPVVSSIGVTDEGELMNVNADQAATALAATLGADLILLSD
VSGILDGKGQRIAEMTAEKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHAE
QLPALFNGTPIGTRILA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory