Comparing BWI76_RS01280 FitnessBrowser__Koxy:BWI76_RS01280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P25665 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Cobalamin-independent methionine synthase; Methionine synthase, vitamin-B12 independent isozyme; EC 2.1.1.14 from Escherichia coli (strain K12) (see 3 papers)
93% identity, 100% coverage: 1:753/753 of query aligns to 1:753/753 of P25665
Q9UT19 Probable 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Cobalamin-independent methionine synthase; Methionine synthase, vitamin-B12 independent isozyme; EC 2.1.1.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 99% coverage: 7:752/753 of query aligns to 6:761/764 of Q9UT19
P82610 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Cobalamin-independent methionine synthase; Methionine synthase, vitamin-B12 independent isozyme; EC 2.1.1.14 from Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (see 4 papers)
50% identity, 99% coverage: 5:751/753 of query aligns to 4:764/767 of P82610
Sites not aligning to the query:
4l6hA Crystal structure of the candida albicans methionine synthase in complex with methotrexate and homocysteine (see paper)
49% identity, 99% coverage: 5:751/753 of query aligns to 4:758/761 of 4l6hA
4l61A Crystal structure of the candida albicans methionine synthase in complex with methionine (see paper)
49% identity, 99% coverage: 5:751/753 of query aligns to 4:753/755 of 4l61A
4qquA Crystal structure of the cobalamin-independent methionine synthase enzyme in a closed conformation (see paper)
49% identity, 99% coverage: 5:751/753 of query aligns to 4:763/766 of 4qquA
O50008 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1; Cobalamin-independent methionine synthase 1; AtMS1; Vitamin-B12-independent methionine synthase 1; EC 2.1.1.14 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
50% identity, 99% coverage: 5:752/753 of query aligns to 3:759/765 of O50008
4l6oA Crystal structure of the candida albicans methionine synthase in complex with glutamine (see paper)
49% identity, 99% coverage: 5:751/753 of query aligns to 4:743/746 of 4l6oA
3ppcB Crystal structure of the candida albicans methionine synthase by surface entropy reduction, tyrosine variant with zinc (see paper)
49% identity, 99% coverage: 5:751/753 of query aligns to 5:732/735 of 3ppcB
4ztxA Neurospora crassa cobalamin-independent methionine synthase complexed with zn2+ (see paper)
47% identity, 100% coverage: 3:752/753 of query aligns to 1:762/768 of 4ztxA
1u22A A. Thaliana cobalamine independent methionine synthase (see paper)
49% identity, 99% coverage: 5:752/753 of query aligns to 2:745/746 of 1u22A
1u1jA A. Thaliana cobalamine independent methionine synthase (see paper)
49% identity, 99% coverage: 5:752/753 of query aligns to 2:745/746 of 1u1jA
1u1hA A. Thaliana cobalamine independent methionine synthase (see paper)
49% identity, 99% coverage: 5:752/753 of query aligns to 2:745/746 of 1u1hA
4l64A Crystal structure of the candida albicans methionine synthase in complex with 5-methyl-tetrahydrofolate (see paper)
48% identity, 99% coverage: 5:751/753 of query aligns to 4:733/733 of 4l64A
P80877 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Cobalamin-independent methionine synthase; Methionine synthase, vitamin-B12 independent isozyme; Superoxide-inducible protein 9; SOI9; EC 2.1.1.14 from Bacillus subtilis (strain 168) (see 2 papers)
46% identity, 100% coverage: 2:751/753 of query aligns to 3:755/762 of P80877
Sites not aligning to the query:
Q8CWX6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Cobalamin-independent methionine synthase; Methionine synthase, vitamin-B12 independent isozyme; EC 2.1.1.14 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
45% identity, 99% coverage: 7:752/753 of query aligns to 6:741/745 of Q8CWX6
1xpgA Crystal structure of t. Maritima cobalamin-independent methionine synthase complexed with zn2+ and methyltetrahydrofolate (see paper)
42% identity, 99% coverage: 6:752/753 of query aligns to 5:731/734 of 1xpgA
Q9X112 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Cobalamin-independent methionine synthase; Methionine synthase, vitamin-B12 independent isozyme; EC 2.1.1.14 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see 2 papers)
42% identity, 99% coverage: 6:752/753 of query aligns to 4:730/734 of Q9X112
1t7lA Crystal structure of cobalamin-independent methionine synthase from t. Maritima (see paper)
42% identity, 99% coverage: 6:752/753 of query aligns to 5:731/734 of 1t7lA
1xdjA Crystal structure of t. Maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (see paper)
43% identity, 99% coverage: 6:752/753 of query aligns to 4:719/722 of 1xdjA
>BWI76_RS01280 FitnessBrowser__Koxy:BWI76_RS01280
MTIINHTLGFPRVGLRRELKKAQESYWAGNTGREELLAVGRELRARHWDQQKQAGVDLLP
VGDFAWYDHVLTTSLLLGNVPARHQNKDGSVDIDTLFRIGRGRAPTGEPAAAAEMTKWFN
TNYHYMVPEFVKGQRFKLSWTQLLDEVDEALALGHKAKPVLLGPVTYLWLGKVKGEPFDR
LSLLNDILPVYRQVLAELAKRGIEWVQIDEPALVLELPQAWLDAFKPAYEALNGEVKLLL
TTYFEGIADNLDTITALPVQGLHVDLVHGQDNVAELHKRLPADWLLSAGLINGRNVWRAD
LSEKYAQVKAIVGKRELWVASSCSLLHSPIDLSVETRLDAEVKSWFAFALQKCEELALLR
DALNSGDTAAIAEWSAPIQARRHSTRVHNAAVEKRLAAITAQDSQRQSAYQVRAAAQRAR
FKLPAWPTTTIGSFPQTTEIRGLRLDFKKGNLDANNYRTGIAEHIRQAIMEQERLGLDVL
VHGEAERNDMVEYFGEHLDGFIFTQNGWVQSYGSRCVKPPVVIGDVSRPEAITVEWAKYA
QSLTEKPVKGMLTGPVTILCWSFPREDVTRETIAKQIALALRDEVADLEAAGIGIIQIDE
PALREGLPLKRSDWDAYLAWGVEAFRINAAVAQDDTQIHTHMCYCEFNDIMDSIAALDAD
VITIETSRSDMELLESFEEFDYPNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPAERL
WVNPDCGLKTRGWPETLSALTNMVKAAQNLRQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory