SitesBLAST
Comparing BWI76_RS01295 FitnessBrowser__Koxy:BWI76_RS01295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hwuA Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uridine and phosphate ion at 2.91a resolution
98% identity, 100% coverage: 1:253/253 of query aligns to 1:253/253 of 2hwuA
- active site: R30 (= R30), R48 (= R48), R91 (= R91), R168 (= R168), I220 (= I220), V221 (= V221)
- binding uridine: T94 (= T94), T95 (= T95), G96 (= G96), F162 (= F162), Q166 (= Q166), E196 (= E196), M197 (= M197), E198 (= E198)
2hn9A Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 2.12a resolution
98% identity, 100% coverage: 1:253/253 of query aligns to 1:253/253 of 2hn9A
1u1eA Structure of e. Coli uridine phosphorylase complexed to 5(phenylseleno)acyclouridine (psau) (see paper)
97% identity, 100% coverage: 1:253/253 of query aligns to 1:253/253 of 1u1eA
- active site: H8 (= H8), G26 (= G26), R30 (= R30), R48 (= R48), E80 (= E80), R91 (= R91), T94 (= T94), R168 (= R168), I220 (= I220), V221 (= V221), R223 (= R223), M234 (= M234)
- binding 1-((2-hydroxyethoxy)methyl)-5-(phenylselanyl)pyrimidine-2,4(1h,3h)-dione: F7 (= F7), H8 (= H8), T94 (= T94), T95 (= T95), G96 (= G96), F162 (= F162), Q166 (= Q166), R168 (= R168), E196 (= E196), M197 (= M197), I220 (= I220), E227 (= E227), P229 (= P229)
- binding phosphate ion: G26 (= G26), R30 (= R30), R91 (= R91), G93 (= G93), T94 (= T94)
1u1dA Structure of e. Coli uridine phosphorylase complexed to 5- (phenylthio)acyclouridine (ptau) (see paper)
97% identity, 100% coverage: 1:253/253 of query aligns to 1:253/253 of 1u1dA
- active site: H8 (= H8), G26 (= G26), R30 (= R30), R48 (= R48), E80 (= E80), R91 (= R91), T94 (= T94), R168 (= R168), I220 (= I220), V221 (= V221), R223 (= R223), M234 (= M234)
- binding 1-((2-hydroxyethoxy)methyl)-5-(phenylthio)pyrimidine-2,4(1h,3h)-dione: F7 (= F7), H8 (= H8), T94 (= T94), T95 (= T95), G96 (= G96), F162 (= F162), Q166 (= Q166), R168 (= R168), M197 (= M197), I220 (= I220), P229 (= P229)
- binding phosphate ion: G26 (= G26), R30 (= R30), R91 (= R91), G93 (= G93), T94 (= T94)
1u1cA Structure of e. Coli uridine phosphorylase complexed to 5- benzylacyclouridine (bau) (see paper)
97% identity, 100% coverage: 1:253/253 of query aligns to 1:253/253 of 1u1cA
- active site: H8 (= H8), G26 (= G26), R30 (= R30), R48 (= R48), E80 (= E80), R91 (= R91), T94 (= T94), R168 (= R168), I220 (= I220), V221 (= V221), R223 (= R223), M234 (= M234)
- binding 1-((2-hydroxyethoxy)methyl)-5-benzylpyrimidine-2,4(1h,3h)-dione: F7 (= F7), H8 (= H8), T94 (= T94), T95 (= T95), G96 (= G96), F162 (= F162), Q166 (= Q166), R168 (= R168), E196 (= E196), I220 (= I220), P229 (= P229)
- binding phosphate ion: G26 (= G26), R30 (= R30), R91 (= R91), G93 (= G93), T94 (= T94), E198 (= E198)
P12758 Uridine phosphorylase; UPase; UrdPase; EC 2.4.2.3 from Escherichia coli (strain K12) (see 3 papers)
97% identity, 100% coverage: 1:253/253 of query aligns to 1:253/253 of P12758
- M1 (= M1) modified: Initiator methionine, Removed
- D5 (= D5) mutation D->A,E,N: No change in activity.
1tgyA Structure of e. Coli uridine phosphorylase complexed with uracil and ribose 1-phosphate
97% identity, 99% coverage: 4:253/253 of query aligns to 1:250/250 of 1tgyA
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223), M231 (= M234)
- binding 1-O-phosphono-alpha-D-ribofuranose: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), R88 (= R91), T91 (= T94), F159 (= F162), M194 (= M197), E195 (= E198)
- binding uracil: G93 (= G96), F159 (= F162), Q163 (= Q166), R165 (= R168)
1rxcJ E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
97% identity, 99% coverage: 4:253/253 of query aligns to 1:250/250 of 1rxcJ
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223), M231 (= M234)
- binding 5-fluorouridine: I66 (= I69), T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), E193 (= E196), M194 (= M197), E195 (= E198), I217 (= I220)
- binding potassium ion: E46 (= E49), G65 (= G68), I66 (= I69), S70 (= S73)
- binding phosphate ion: G23 (= G26), R27 (= R30), R88 (= R91), G90 (= G93), T91 (= T94)
- binding 1-O-phosphono-alpha-D-ribofuranose: H5 (= H8), R45 (= R48)
1rxcB E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
97% identity, 99% coverage: 4:253/253 of query aligns to 1:250/250 of 1rxcB
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223), M231 (= M234)
- binding potassium ion: E46 (= E49), G65 (= G68), I66 (= I69), S70 (= S73)
- binding 1-O-phosphono-alpha-D-ribofuranose: G23 (= G26), R27 (= R30), R88 (= R91), T91 (= T94), E193 (= E196), M194 (= M197), E195 (= E198)
- binding 5-fluorouracil: T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), I217 (= I220), V218 (= V221)
1rxcA E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
96% identity, 99% coverage: 4:253/253 of query aligns to 1:246/246 of 1rxcA
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223)
- binding potassium ion: E46 (= E49), G65 (= G68), I66 (= I69), S70 (= S73)
- binding 1-O-phosphono-alpha-D-ribofuranose: H5 (= H8), R45 (= R48)
1rxsB E. Coli uridine phosphorylase: 2'-deoxyuridine phosphate complex (see paper)
96% identity, 99% coverage: 4:253/253 of query aligns to 1:246/246 of 1rxsB
- active site: H5 (= H8), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223)
- binding 2'-deoxyuridine: T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), M194 (= M197), E195 (= E198)
- binding potassium ion: E46 (= E49), G65 (= G68), I66 (= I69), S70 (= S73)
- binding meta vanadate: R175 (≠ S178), H176 (≠ R179)
1u1gA Structure of e. Coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)barbituric acid (bbba) (see paper)
95% identity, 99% coverage: 4:253/253 of query aligns to 1:245/245 of 1u1gA
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223), M226 (= M234)
- binding 1-((2-hydroxyethoxy)methyl)-5-(3-(benzyloxy)benzyl)-6-hydroxypyrimidine-2,4(1h,3h)-dione: T91 (= T94), T92 (= T95), F159 (= F162), Q163 (= Q166), R165 (= R168), M194 (= M197), I217 (= I220), V218 (= V221)
1zl2B Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine and phosphate ion at 1.85a resolution
94% identity, 99% coverage: 4:253/253 of query aligns to 1:242/242 of 1zl2B
- active site: R27 (= R30), R45 (= R48), R88 (= R91), R165 (= R168), I217 (= I220), V218 (= V221)
- binding 2,2'-Anhydro-(1-beta-D-arabinofuranosyl)uracil: T91 (= T94), T92 (= T95), F159 (= F162), Q163 (= Q166), R165 (= R168), E193 (= E196), M194 (= M197), E195 (= E198), I217 (= I220)
1y1rB Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate ion at 2.11a resolution
94% identity, 99% coverage: 4:253/253 of query aligns to 1:242/242 of 1y1rB
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223)
- binding 2,2'-Anhydro-(1-beta-D-ribofuranosyl)uracil: I66 (= I69), T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), R165 (= R168), E193 (= E196), M194 (= M197), E195 (= E198), I217 (= I220)
3kvvA Trapping of an oxocarbenium ion intermediate in up crystals (see paper)
94% identity, 99% coverage: 4:253/253 of query aligns to 1:243/243 of 3kvvA
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223)
- binding 1,4-anhydro-D-erythro-pent-1-enitol: T91 (= T94), F159 (= F162), E193 (= E196), M194 (= M197), E195 (= E198)
- binding sulfate ion: G23 (= G26), R27 (= R30), R88 (= R91), G90 (= G93), T91 (= T94)
- binding 5-fluorouracil: T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), R165 (= R168), I217 (= I220), V218 (= V221)
1u1fA Structure of e. Coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)acyclouridine (bbau) (see paper)
94% identity, 99% coverage: 4:253/253 of query aligns to 1:243/243 of 1u1fA
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223), M224 (= M234)
- binding 1-((2-hydroxyethoxy)methyl)-5-(3-(benzyloxy)benzyl)pyrimidine-2,4(1h,3h)-dione: F4 (= F7), H5 (= H8), R45 (= R48), T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), R165 (= R168), E193 (= E196), M194 (= M197), I217 (= I220), V218 (= V221), M224 (= M234)
- binding phosphate ion: G23 (= G26), R27 (= R30), R88 (= R91), G90 (= G93), T91 (= T94)
1rxsa E. Coli uridine phosphorylase: 2'-deoxyuridine phosphate complex (see paper)
94% identity, 99% coverage: 4:253/253 of query aligns to 1:242/242 of 1rxsa
- active site: H5 (= H8), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), R165 (= R168), I217 (= I220), V218 (= V221), R220 (= R223)
- binding 2'-deoxyuridine: I66 (= I69), T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), R165 (= R168), M194 (= M197), E195 (= E198)
- binding potassium ion: E46 (= E49), G65 (= G68), I66 (= I69), S70 (= S73)
1y1qC Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uridine-5p-monophosphate and sulfate ion at 2.35a resolution
94% identity, 99% coverage: 4:253/253 of query aligns to 1:240/240 of 1y1qC
- active site: R27 (= R30), R45 (= R48), R88 (= R91), R165 (= R168), I217 (= I220), V218 (= V221)
- binding uridine-5'-monophosphate: R88 (= R91), T91 (= T94), T92 (= T95), G93 (= G96), F159 (= F162), Q163 (= Q166), Y192 (= Y195), E193 (= E196), M194 (= M197)
5efoB X-ray structure uridine phosphorylase from vibrio cholerae in complex with cytidine and cytosine at 1.63a.
76% identity, 100% coverage: 1:253/253 of query aligns to 1:252/253 of 5efoB
- active site: H7 (= H8), G25 (= G26), R29 (= R30), R47 (= R48), E79 (= E80), R90 (= R91), T93 (= T94), R167 (= R168), I219 (= I220), I220 (≠ V221), R222 (= R223), L233 (≠ M234)
- binding 6-aminopyrimidin-2(1h)-one: T94 (= T95), G95 (= G96), F161 (= F162), Q165 (= Q166)
6rcaA X-ray structure uridine phosphorylase from vibrio cholerae in complex with 2.2'-anhydrouridine at 1.34 a
77% identity, 98% coverage: 6:253/253 of query aligns to 3:250/251 of 6rcaA
- active site: H5 (= H8), G23 (= G26), R27 (= R30), R45 (= R48), E77 (= E80), R88 (= R91), T91 (= T94), R165 (= R168), I217 (= I220), I218 (≠ V221), R220 (= R223), L231 (≠ M234)
- binding 2,2'-Anhydro-(1-beta-D-ribofuranosyl)uracil: T91 (= T94), F159 (= F162), Q163 (= Q166), E193 (= E196), M194 (= M197), E195 (= E198)
Query Sequence
>BWI76_RS01295 FitnessBrowser__Koxy:BWI76_RS01295
MSKSDVFHLGLTKNDLQGATLAIVPGDPERVEKIAALMDKPVKLASHREFTTWRAELDGK
AVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGAS
LHFAPMEFPAVADFECTTALVEAAKSIGATTHIGVTASSDTFYPGQERYDTFSGRVVSRF
KGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESH
AVKIVVEAARRLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory