SitesBLAST
Comparing BWI76_RS01365 BWI76_RS01365 multifunctional fatty acid oxidation complex subunit alpha to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
94% identity, 100% coverage: 1:729/729 of query aligns to 1:729/729 of P21177
- G116 (= G116) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G322) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H450) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
94% identity, 99% coverage: 1:719/729 of query aligns to 1:719/719 of 6tnmA
- active site: A68 (= A68), F73 (= F73), G116 (= G116), E119 (= E119), P138 (= P138), E139 (= E139), G147 (= G147), N271 (= N271), S429 (= S429), H450 (= H450), E462 (= E462), N500 (= N500)
- binding adenosine-5'-triphosphate: D343 (= D343), I344 (= I344), V400 (= V400), V401 (= V401), V406 (= V406), K584 (= K584)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
56% identity, 98% coverage: 1:714/729 of query aligns to 1:714/715 of 1wdlA
- active site: A69 (= A68), N89 (≠ L88), N93 (= N92), G117 (= G116), E120 (= E119), P139 (= P138), E140 (= E139), P147 (= P146), G148 (= G147), S430 (= S429), H451 (= H450), E463 (= E462), N501 (= N500)
- binding nicotinamide-adenine-dinucleotide: A322 (= A321), I324 (= I323), M325 (= M324), D344 (= D343), I345 (= I344), A400 (= A399), V401 (= V400), E403 (= E402), N428 (= N427), T429 (= T428), S430 (= S429)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
56% identity, 98% coverage: 1:714/729 of query aligns to 1:714/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
56% identity, 98% coverage: 1:714/729 of query aligns to 1:706/707 of 1wdmA
- active site: A69 (= A68), N89 (≠ L88), N93 (= N92), G117 (= G116), E120 (= E119), P139 (= P138), E140 (= E139), P147 (= P146), G148 (= G147), S430 (= S429), H451 (= H450), E463 (= E462), N501 (= N500)
- binding acetyl coenzyme *a: K142 (= K141), D297 (= D296), M459 (= M458), N501 (= N500), P534 (= P534), Y652 (= Y660), L658 (≠ P666)
- binding nicotinamide-adenine-dinucleotide: G321 (= G320), A322 (= A321), I324 (= I323), M325 (= M324), D344 (= D343), V401 (= V400), E403 (= E402), N428 (= N427), S430 (= S429), N454 (= N453)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
35% identity, 93% coverage: 17:691/729 of query aligns to 49:737/763 of P40939
- V282 (= V240) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ V255) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ I292) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E462) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
35% identity, 93% coverage: 10:689/729 of query aligns to 6:677/707 of 6yswA
- active site: A66 (= A68), I71 (≠ F73), A84 (≠ S85), Q88 (≠ N92), G112 (= G116), E115 (= E119), P136 (= P138), E137 (= E139), G145 (= G147), D264 (≠ N271), S422 (= S429), H443 (= H450), E455 (= E462), N493 (= N500)
- binding coenzyme a: E23 (≠ S27), M25 (≠ V28), A66 (= A68), D67 (= D69), I68 (= I70), P136 (= P138), E137 (= E139), L140 (= L142), T290 (≠ Q297), K293 (= K300)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
33% identity, 91% coverage: 14:679/729 of query aligns to 7:654/692 of 6iunB
- active site: A60 (= A68), F65 (= F73), E73 (≠ S85), H77 (= H89), G101 (= G116), E104 (= E119), E124 (= E139), G132 (= G147), K248 (≠ N271), S407 (= S429), H428 (= H450), E440 (= E462), N478 (= N500)
- binding nicotinamide-adenine-dinucleotide: G300 (= G322), T301 (≠ I323), M302 (= M324), E321 (≠ D343), T322 (≠ I344), Y365 (= Y387), A377 (= A399), V378 (= V400), E380 (= E402), V384 (= V406), V388 (= V410), N405 (= N427), S407 (= S429)
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
34% identity, 92% coverage: 6:675/729 of query aligns to 11:690/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ T33), G74 (= G67), M80 (≠ F73), V91 (= V94), T94 (≠ R97), T94 (≠ R97), E148 (= E139), L151 (= L142), R182 (≠ D172), S448 (= S429), S519 (≠ N500), R520 (= R501), L562 (≠ V544), L566 (≠ T548), I570 (≠ A552)
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
34% identity, 92% coverage: 6:675/729 of query aligns to 13:692/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G67), G77 (≠ A68), T81 (≠ E72), M82 (≠ F73), M82 (≠ F73), A85 (≠ L76), D89 (≠ E82), T96 (≠ R97), L123 (= L114), G124 (= G115), P149 (= P138), E150 (= E139), S366 (≠ N345), L367 (≠ D346), E368 (≠ K347), A420 (= A399), V421 (= V400), F422 (≠ V401)
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
34% identity, 92% coverage: 6:675/729 of query aligns to 7:686/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
34% identity, 92% coverage: 6:675/729 of query aligns to 7:686/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (= G26), S29 (= S27), A63 (≠ E60), K64 (= K61), K64 (= K61), K65 (≠ A62), P143 (= P138), E144 (= E139), L147 (= L142), F307 (≠ L294), M473 (= M458), P548 (= P534), S599 (≠ F581), L602 (≠ K584), K603 (≠ N585), S661 (= S650), T662 (≠ P651), G674 (= G663)
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
34% identity, 92% coverage: 6:675/729 of query aligns to 12:691/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
34% identity, 92% coverage: 6:675/729 of query aligns to 12:691/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ K30), N39 (≠ D32), G75 (= G67), D77 (= D69), M81 (≠ F73), V92 (= V94), T95 (≠ R97), P148 (= P138), E149 (= E139), L152 (= L142), Q180 (≠ A169), Q260 (= Q242), K362 (= K342), D363 (= D343), V364 (≠ I344), V430 (= V410), D476 (≠ H456), K477 (≠ R457), M478 (= M458), P479 (= P459), K506 (= K486)
- binding formamide: V78 (≠ I70), K79 (≠ T71)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
34% identity, 92% coverage: 6:675/729 of query aligns to 13:692/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G67), F169 (≠ L158), N173 (≠ S162), S177 (≠ E165), I193 (= I181), F313 (≠ L294)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ L31), N40 (≠ D32), E41 (≠ T33), T81 (≠ E72), D92 (≠ S93), V93 (= V94)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ L31), G77 (≠ A68), D78 (= D69), M82 (≠ F73), V93 (= V94)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ K141), R184 (≠ D172), A311 (≠ I292), F312 (= F293), I673 (≠ M656)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
34% identity, 92% coverage: 6:675/729 of query aligns to 14:693/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ L31), N41 (≠ D32), E42 (≠ T33), G77 (= G67), G78 (≠ A68), D79 (= D69), V80 (≠ I70), D90 (≠ E82), V94 (= V94), L124 (= L114), G125 (= G115), P150 (= P138), E151 (= E139)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
34% identity, 92% coverage: 6:675/729 of query aligns to 13:692/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ T33), G76 (= G67), G77 (≠ A68), D78 (= D69), V79 (≠ I70), M82 (≠ F73), D89 (≠ E82), V93 (= V94), T96 (≠ R97), T96 (≠ R97), P149 (= P138), E150 (= E139)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
34% identity, 92% coverage: 6:675/729 of query aligns to 13:692/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ L31), M82 (≠ F73), E150 (= E139), Q172 (≠ D161), F175 (vs. gap), V176 (≠ L164), Q181 (≠ A169), T241 (≠ E220), F254 (≠ I235), N257 (≠ G238), Q261 (= Q242), L262 (≠ T243), P266 (≠ H247), P268 (= P249), Q282 (≠ R263), V283 (≠ F264), G302 (≠ T283), Q303 (≠ N284), V304 (≠ E285), S521 (≠ N500), G525 (≠ F504)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
34% identity, 92% coverage: 6:675/729 of query aligns to 13:692/729 of 8opvA
- binding resveratrol: M39 (≠ L31), A75 (≠ V66), G76 (= G67), M82 (≠ F73), E128 (= E119), P149 (= P138), E150 (= E139), T152 (≠ K141), L153 (= L142), R184 (≠ D172), F296 (= F277)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
34% identity, 92% coverage: 6:675/729 of query aligns to 13:692/729 of 8opuA
Query Sequence
>BWI76_RS01365 BWI76_RS01365 multifunctional fatty acid oxidation complex subunit alpha
MLYKGDTLYLDWREDGIAELVFDAPGSVNKLDTATVASLGEALDVLEKQKDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDLGAEQALK
IGLVDGVVKHEKLIDGAVAILRQAINGDLDWKAKRQPKLEPLHLSKIEAAMSFTIAKGMV
AQTAGKHYPAPLTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVDTPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKMAGVISTIQPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEEKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGDKTSDKTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDAKRFGQKNGLGFWRYKEDSKGKP
KKEEDTVVDSLLAEVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLRSKARHNEPYYPPVEPA
RAPGDLKTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory