SitesBLAST
Comparing BWI76_RS01715 FitnessBrowser__Koxy:BWI76_RS01715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P44774 Shikimate dehydrogenase-like protein HI_0607; SDH-L; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
63% identity, 100% coverage: 1:268/269 of query aligns to 1:268/271 of P44774
- K67 (= K67) mutation K->A,H,N: Loss of activity.
- D103 (= D103) mutation D->A,N: Loss of activity.
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
31% identity, 94% coverage: 1:252/269 of query aligns to 1:252/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ M64), G132 (= G128), G133 (= G129), A134 (≠ M130), N153 (≠ A150), R154 (= R151), T155 (≠ H152), T188 (= T183), S189 (≠ P184), V190 (≠ L185)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ N18), S21 (≠ G20), N64 (≠ A61), K70 (= K67), N91 (= N88), D106 (= D103), Y216 (≠ A214), L239 (≠ I239), Q242 (= Q242)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
31% identity, 94% coverage: 1:252/269 of query aligns to 1:252/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ M64), G130 (= G126), G133 (= G129), A134 (≠ M130), N153 (≠ A150), R154 (= R151), T155 (≠ H152), K158 (≠ R155), T188 (= T183), S189 (≠ P184), V190 (≠ L185), I214 (≠ V212), M238 (≠ V238), L239 (≠ I239)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ N18), S21 (≠ G20), N64 (≠ A61), T66 (≠ S63), K70 (= K67), N91 (= N88), D106 (= D103), Y216 (≠ A214), L239 (≠ I239), Q242 (= Q242)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
31% identity, 94% coverage: 1:252/269 of query aligns to 1:252/269 of O67049
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
30% identity, 98% coverage: 1:263/269 of query aligns to 6:280/287 of 1nvtB
- active site: K75 (= K67), D111 (= D103)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (≠ M64), G135 (≠ Q125), G137 (≠ S127), G138 (= G131), A139 (≠ K132), N157 (≠ A150), R158 (= R151), T159 (≠ H152), K162 (≠ R155), A200 (≠ V182), T201 (= T183), P202 (= P184), I203 (≠ L185), M205 (= M187), L229 (≠ V212), Y231 (≠ A214), M255 (≠ V238), L256 (≠ I239)
- binding zinc ion: E22 (vs. gap), H23 (≠ G17)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
30% identity, 98% coverage: 1:263/269 of query aligns to 6:280/287 of 1nvtA
- active site: K75 (= K67), D111 (= D103)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (≠ Q125), A139 (≠ K132), N157 (≠ A150), R158 (= R151), T159 (≠ H152), K162 (≠ R155), A200 (≠ V182), T201 (= T183), P202 (= P184), I203 (≠ L185), M205 (= M187), L229 (≠ V212), Y231 (≠ A214), G252 (= G235), M255 (≠ V238), L256 (≠ I239)
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 98% coverage: 1:263/269 of query aligns to 1:275/282 of Q58484
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
33% identity, 86% coverage: 22:252/269 of query aligns to 18:266/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (≠ S127), G127 (= G128), G128 (= G129), A129 (≠ M130), R150 (= R151), F154 (vs. gap), K199 (≠ P184), V200 (≠ L185), M202 (= M187), C226 (≠ V212), Y228 (≠ A214), M252 (≠ V238), L253 (≠ I239)
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
33% identity, 86% coverage: 22:252/269 of query aligns to 24:272/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (≠ S127), G133 (= G128), G134 (= G129), A135 (≠ M130), N155 (≠ A150), R156 (= R151), D158 (≠ R153), F160 (vs. gap), T204 (= T183), K205 (≠ P184), V206 (≠ L185), M208 (= M187), C232 (≠ V212), M258 (≠ V238), L259 (≠ I239)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 86% coverage: 22:252/269 of query aligns to 24:272/288 of P0A6D5
- Y39 (= Y37) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (= S63) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K67) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N88) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (= T102) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D103) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (≠ SGGM 127:130) binding
- NRRD 155:158 (≠ ARHR 150:153) binding
- K205 (≠ P184) binding
- CVYN 232:235 (≠ VVAL 212:215) binding
- G255 (= G235) binding
- Q262 (= Q242) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 22 S→A: Kinetically unchanged as compared with the wild-type.
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
31% identity, 86% coverage: 22:252/269 of query aligns to 24:272/288 of Q8ZPR4
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
31% identity, 85% coverage: 23:251/269 of query aligns to 31:277/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G126), A138 (≠ S127), G139 (= G128), G140 (= G129), A141 (≠ M130), N161 (≠ A150), R162 (= R151), D164 (≠ R153), F166 (vs. gap), T210 (= T183), G211 (≠ P184), V212 (≠ L185), M214 (= M187), F217 (≠ A191), V238 (= V212), Y240 (≠ A214), G261 (= G235), M264 (≠ V238), M265 (≠ I239)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
31% identity, 85% coverage: 23:251/269 of query aligns to 31:277/291 of Q8Y9N5
Sites not aligning to the query:
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
31% identity, 85% coverage: 23:251/269 of query aligns to 28:274/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (= M64), G134 (= G126), A135 (≠ S127), G136 (= G128), G137 (= G129), A138 (≠ M130), N158 (≠ A150), R159 (= R151), D161 (≠ R153), F163 (vs. gap), T207 (= T183), V209 (≠ L185), M211 (= M187), F214 (≠ A191), V235 (= V212), Y237 (≠ A214), M261 (≠ V238), M262 (≠ I239)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: N68 (≠ A61), S70 (= S63), K74 (= K67), N95 (= N88), D110 (= D103), Q265 (= Q242)
Sites not aligning to the query:
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
33% identity, 92% coverage: 23:269/269 of query aligns to 19:262/263 of 2ev9B
- active site: K64 (= K67), D100 (= D103)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: N58 (≠ A61), T60 (≠ S63), K64 (= K67), N85 (= N88), D100 (= D103), Q235 (= Q242)
Sites not aligning to the query:
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 92% coverage: 23:269/269 of query aligns to 19:262/263 of Q5SJF8
Sites not aligning to the query:
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
33% identity, 92% coverage: 23:269/269 of query aligns to 19:262/262 of 2cy0A
- active site: K64 (= K67), D100 (= D103)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G123 (= G126), G126 (= G129), A127 (≠ M130), N146 (≠ A150), R147 (= R151), T148 (≠ H152), R151 (= R155), T179 (= T183), R180 (≠ P184), V181 (≠ L185), L205 (≠ V212), L232 (≠ I239)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
31% identity, 92% coverage: 23:269/269 of query aligns to 1282:1550/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279
- binding zinc ion: 187, 264, 280
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
31% identity, 86% coverage: 24:253/269 of query aligns to 253:478/501 of 2o7qA
Sites not aligning to the query:
- active site: 70, 125, 152
- binding 3-dehydroshikimate: 35, 152, 190, 202, 211, 212, 215, 239, 247, 249
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
32% identity, 86% coverage: 24:253/269 of query aligns to 253:477/500 of 2o7sA
- binding 3-dehydroshikimate: T292 (≠ S63), K296 (= K67), N317 (= N88), D334 (= D103), Y438 (≠ A214), Q466 (= Q242), Q470 (= Q246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I293 (≠ M64), P294 (= P65), K296 (= K67), D334 (= D103), G354 (= G128), G355 (= G129), A356 (≠ M130), N374 (≠ A150), R375 (= R151), T376 (≠ H152), R379 (= R155), T409 (= T183), S410 (≠ P184), M411 (≠ L185), A436 (≠ V212), M462 (≠ V238), F463 (≠ I239)
Sites not aligning to the query:
- active site: 70, 125, 152
- binding 3-dehydroshikimate: 35, 152, 190, 202, 211, 212, 215, 239, 247, 249
Query Sequence
>BWI76_RS01715 FitnessBrowser__Koxy:BWI76_RS01715
MINRDTQLCMSLAGRPGNFGTRFHNYLYEKLGLNYIYKAFTTQDIAAAVNGVRALGVRGC
AVSMPFKESCIPFLDALDPSAKVIDSVNTIVNDDGRLTGLNTDYIAVKSLIDSHRLDASA
KVMIQGSGGMGKAVIAAFRDAGFRDVIIAARHRERGLALAKQYGFQWQPRPEGMAADILV
NVTPLGMAGGAESETLAFSQTMVERAAVVFDVVALPPETPLIRLAQRLDKRVISGAEVIA
LQAVEQFALYTGVRPDAALVAEAAAFARG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory