Comparing BWI76_RS01720 FitnessBrowser__Koxy:BWI76_RS01720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
26% identity, 52% coverage: 8:221/409 of query aligns to 7:207/348 of 1e3jA
Sites not aligning to the query:
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
25% identity, 54% coverage: 2:221/409 of query aligns to 2:209/351 of 3qe3A
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
23% identity, 54% coverage: 2:221/409 of query aligns to 8:215/357 of P27867
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
26% identity, 54% coverage: 2:221/409 of query aligns to 6:212/354 of P07846
Sites not aligning to the query:
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
23% identity, 67% coverage: 5:277/409 of query aligns to 5:264/357 of 7y9pA
>BWI76_RS01720 FitnessBrowser__Koxy:BWI76_RS01720
MQTTALRLYGKRDLRLETFELPAMQDDEILARVVTDSLCLSSWKEANQGEDHKKVPDDVA
TNPIIIGHEFCGEIIAVGKKWQHKFRAGQRYVIQANLQLPDRPDCPGYSFPWIGGEATHV
VIPNEVMEQDCLLSWEGDTWFEGSLVEPLSCVIGAFNANYHLQEGSYNHVMGIRPQGRTL
ILGGTGPMGLLAIDYALHGPINPALLVVTDTNKPKLSYARQHYPSEPQTLIHYLDGRDAS
RETLMALSGGHGFDDIFVFVPNEQLITLASSLLAADGCLNFFAGPQDKQFSAPINFYDVH
YAFTHYVGTSGGNTDDMRAAVALMQAKKVQAAKVVTHILGLNAAGETTLDLPAVGGGKKL
VYTGKNIPLTPLGEIRDPQLAAIMERHHGIWSKEAEEYLLAHAEDIAHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory