Comparing BWI76_RS01725 FitnessBrowser__Koxy:BWI76_RS01725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7dyrZ Cryoem structure of mannose transporter manyz and microcin e492 (mcea) complex (see paper)
62% identity, 99% coverage: 3:273/274 of query aligns to 1:272/274 of 7dyrZ
7xnoZ Cryo-em structure of the bacteriocin-receptor-immunity ternary complex from lactobacillus sakei (see paper)
46% identity, 99% coverage: 2:273/274 of query aligns to 1:301/301 of 7xnoZ
8hfsZ The structure of lcna, lcia, and the man-pts of lactococcus lactis (see paper)
48% identity, 93% coverage: 13:268/274 of query aligns to 11:298/303 of 8hfsZ
7vlxZ Cryo-em structures of listeria monocytogenes man-pts (see paper)
45% identity, 98% coverage: 5:273/274 of query aligns to 1:298/298 of 7vlxZ
>BWI76_RS01725 FitnessBrowser__Koxy:BWI76_RS01725
MEQRKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYPLKEDQVAALKRH
LVFFNTTPAVCGPVIGVTVAMEEARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLR
PITAALGASLALSGNLVGPLLFFFIFNAVRLAMKWYGLQLGFRKGVNIVSEMGGNLLQKL
TEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGSTVTMTVQNILDQLCPGLLALGLT
LLMVRLLNKKVNPVWLIFALFGLGILGNALGFLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory