Comparing BWI76_RS01735 FitnessBrowser__Koxy:BWI76_RS01735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P69797 PTS system mannose-specific EIIAB component; EIIAB-Man; EIII-Man; EC 2.7.1.191 from Escherichia coli (strain K12) (see 4 papers)
52% identity, 97% coverage: 1:159/164 of query aligns to 162:320/323 of P69797
Sites not aligning to the query:
P26380 PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 from Bacillus subtilis (strain 168) (see paper)
46% identity, 91% coverage: 1:150/164 of query aligns to 2:151/163 of P26380
>BWI76_RS01735 FitnessBrowser__Koxy:BWI76_RS01735
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDDVRRTLLRQAAPPGMKVNVV
NLEKAVAVYHNPQYQDETVFYLFTNPQDVLTMVQQGVNIATLNIGGMAWRPGKKQLTKAV
SLDEADINAFQQLDKLGVNLDLRVVASDPSVNILDKIAEQSVTE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory