SitesBLAST
Comparing BWI76_RS01745 FitnessBrowser__Koxy:BWI76_RS01745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 96% coverage: 7:263/267 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G20), N111 (= N119), S139 (= S147), Q149 (= Q157), Y152 (= Y160), K156 (= K164)
- binding acetoacetyl-coenzyme a: D93 (vs. gap), K98 (≠ R93), S139 (= S147), N146 (≠ S154), V147 (≠ E155), Q149 (= Q157), Y152 (= Y160), F184 (≠ I192), M189 (≠ G197), K200 (≠ Q217)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ S19), G18 (= G20), I19 (= I21), D38 (= D40), F39 (≠ I41), V59 (≠ T58), D60 (= D59), V61 (≠ I60), N87 (= N86), A88 (= A87), G89 (= G88), I90 (≠ V89), T137 (≠ V145), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), F184 (≠ I192), T185 (≠ L193), T187 (≠ K195), M189 (≠ G197)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 97% coverage: 5:263/267 of query aligns to 1:244/247 of 4jroC
- active site: G16 (= G20), S142 (= S147), Q152 (= Q157), Y155 (= Y160), K159 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ S19), G16 (= G20), I17 (= I21), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (vs. gap), N63 (= N52), V64 (≠ I60), N90 (= N86), A91 (= A87), I93 (≠ V89), I113 (= I118), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), I188 (≠ L193), T190 (≠ G197)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 98% coverage: 5:265/267 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G20), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (= I21), D38 (= D40), I39 (= I41), T61 (= T58), I63 (= I60), N89 (= N86), G91 (= G88), T139 (≠ V145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), I186 (= I192), I187 (≠ L193)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 94% coverage: 14:263/267 of query aligns to 9:243/246 of 3osuA
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
32% identity, 97% coverage: 7:265/267 of query aligns to 11:264/267 of Q9LBG2
- 17:42 (vs. 13:38, 42% identical) binding
- E103 (≠ N90) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
32% identity, 97% coverage: 7:265/267 of query aligns to 2:255/258 of 1iy8A
- active site: G15 (= G20), S143 (= S147), Q153 (= Q157), Y156 (= Y160), K160 (= K164)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), S14 (= S19), G15 (= G20), L16 (≠ I21), D35 (= D40), V36 (≠ I41), A62 (≠ T58), D63 (= D59), V64 (≠ I60), N90 (= N86), G92 (= G88), I93 (≠ V89), T141 (≠ V145), S143 (= S147), Y156 (= Y160), K160 (= K164), P186 (= P190), G187 (= G191), T191 (= T200), P192 (= P201), M193 (≠ E202)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 94% coverage: 14:263/267 of query aligns to 6:236/239 of 3sj7A
- active site: G12 (= G20), S138 (= S147), Q148 (= Q157), Y151 (= Y160), K155 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ A18), R11 (≠ S19), I13 (= I21), N31 (≠ I39), Y32 (≠ H42), A33 (≠ G43), G34 (= G44), S35 (≠ D45), A58 (≠ T58), N59 (≠ D59), V60 (≠ I60), N86 (= N86), A87 (= A87), T109 (≠ I118), S138 (= S147), Y151 (= Y160), K155 (= K164), P181 (= P190), G182 (= G191)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
33% identity, 97% coverage: 5:263/267 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G20), S138 (= S147), Y151 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ S19), T37 (vs. gap), L58 (≠ T58), N59 (≠ D59), V60 (≠ I60), A87 (= A87), G88 (= G88), I89 (≠ V89)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
32% identity, 97% coverage: 4:263/267 of query aligns to 3:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ A18), R18 (≠ S19), I20 (= I21), T40 (vs. gap), N62 (≠ D59), V63 (≠ I60), N89 (= N86), A90 (= A87), I92 (≠ V89), V139 (= V145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), I187 (≠ L193), T189 (≠ K195), M191 (≠ G197)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
32% identity, 97% coverage: 9:267/267 of query aligns to 1:252/253 of 4nbwA
- active site: G12 (= G20), S146 (= S147), Y159 (= Y160), K163 (= K164)
- binding nicotinamide-adenine-dinucleotide: G8 (= G16), N11 (≠ S19), G12 (= G20), I13 (= I21), D32 (= D40), L33 (≠ I41), V57 (≠ T58), D58 (= D59), V59 (≠ I60), N85 (= N86), A86 (= A87), G87 (= G88), S146 (= S147), Y159 (= Y160), K163 (= K164), I192 (≠ L193), T194 (≠ K195)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
33% identity, 96% coverage: 7:263/267 of query aligns to 3:236/239 of 4nbtA
- active site: G16 (= G20), S132 (= S147), Y145 (= Y160), K149 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), K15 (≠ S19), G16 (= G20), L17 (≠ I21), D36 (= D40), L37 (≠ I41), L52 (≠ T58), N53 (≠ D59), V54 (≠ I60), N80 (= N86), A81 (= A87), G82 (= G88), I130 (≠ V145), S132 (= S147), Y145 (= Y160), K149 (= K164), P177 (= P190), G178 (= G191), I180 (≠ L193), T182 (≠ K195)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 97% coverage: 5:263/267 of query aligns to 1:240/244 of P0A2C9
- M125 (= M134) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L246) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S247) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
36% identity, 97% coverage: 5:263/267 of query aligns to 8:250/254 of 4ag3A
- active site: G23 (= G20), S148 (= S147), Y161 (= Y160), K165 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G16), S21 (≠ A18), R22 (≠ S19), G23 (= G20), I24 (= I21), T44 (≠ I39), L68 (≠ T58), D69 (= D59), V70 (≠ I60), N96 (= N86), A97 (= A87), I146 (≠ V145), S148 (= S147), Y161 (= Y160), K165 (= K164), P191 (= P190), G192 (= G191), F193 (≠ I192), I194 (≠ L193), T196 (≠ K195), M198 (≠ G197), T199 (≠ L198)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 77% coverage: 59:263/267 of query aligns to 64:243/247 of P73574
- P151 (≠ E155) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K164) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ I192) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ T214) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
Sites not aligning to the query:
- 14 A→G: 4.2-fold increase in activity on acetoacetyl-CoA.
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 97% coverage: 4:263/267 of query aligns to 3:239/243 of 4i08A
- active site: G19 (= G20), N113 (= N119), S141 (= S147), Q151 (= Q157), Y154 (= Y160), K158 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ A18), R18 (≠ S19), I20 (= I21), T40 (vs. gap), N62 (≠ D59), V63 (≠ I60), N89 (= N86), A90 (= A87), G140 (≠ S146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), T189 (= T200)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 97% coverage: 5:263/267 of query aligns to 1:240/244 of P0AEK2
- GASR 12:15 (≠ GGAS 16:19) binding
- T37 (vs. gap) binding
- NV 59:60 (≠ DI 59:60) binding
- N86 (= N86) binding
- Y151 (= Y160) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAATK 160:164) binding
- A154 (≠ T163) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K164) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ L193) binding
- E233 (≠ V256) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
34% identity, 95% coverage: 10:263/267 of query aligns to 5:239/243 of 7emgB
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
35% identity, 97% coverage: 5:263/267 of query aligns to 14:251/255 of 4bo4C
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
32% identity, 97% coverage: 6:263/267 of query aligns to 1:239/243 of 1q7bA
- active site: G15 (= G20), E101 (≠ A111), S137 (= S147), Q147 (= Q157), Y150 (= Y160), K154 (= K164)
- binding calcium ion: E232 (≠ V256), T233 (= T257)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ A18), R14 (≠ S19), T36 (vs. gap), N58 (≠ D59), V59 (≠ I60), N85 (= N86), A86 (= A87), G87 (= G88), I88 (≠ V89), S137 (= S147), Y150 (= Y160), K154 (= K164), P180 (= P190), G181 (= G191), I183 (≠ L193)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 97% coverage: 7:265/267 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G20), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G16 (= G20), I17 (= I21), D36 (= D40), I37 (= I41), A61 (≠ T58), D62 (= D59), T63 (≠ I60), N89 (= N86), A90 (= A87), M140 (≠ V145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), A186 (≠ G191), Y187 (≠ I192), I188 (≠ L193), L192 (≠ G197)
Query Sequence
>BWI76_RS01745 FitnessBrowser__Koxy:BWI76_RS01745
MNTWLNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDI
SSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQ
KGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGK
HGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVAD
FVCYLLSERASYMTGVTTNIAGGKTRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory