SitesBLAST
Comparing BWI76_RS01830 FitnessBrowser__Koxy:BWI76_RS01830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jyrA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
94% identity, 93% coverage: 27:396/396 of query aligns to 1:370/370 of 3jyrA
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: E44 (= E70), E45 (= E71), R66 (= R92), W340 (= W366), Y341 (= Y367), R344 (= R370)
- binding alpha-D-glucopyranose: D14 (= D40), K15 (= K41), W62 (= W88), D65 (= D91), E111 (= E137), E153 (= E179), P154 (= P180), Y155 (= Y181), Y155 (= Y181), W230 (= W256), W340 (= W366)
4xajB Crystal structure of human nr2e1/tlx (see paper)
93% identity, 93% coverage: 25:392/396 of query aligns to 1:368/570 of 4xajB
1llsA Crystal structure of unliganded maltose binding protein with xenon (see paper)
94% identity, 93% coverage: 27:396/396 of query aligns to 1:370/370 of 1llsA
1ez9B Structure of maltotetraitol bound to open-form maltodextrin binding protein in p1 crystal form (see paper)
94% identity, 93% coverage: 27:396/396 of query aligns to 1:370/370 of 1ez9B
- binding alpha-D-glucopyranose: E111 (= E137), E153 (= E179), E153 (= E179), P154 (= P180), Y155 (= Y181), Y155 (= Y181), F156 (= F182), W230 (= W256), W340 (= W366), W340 (= W366), Y341 (= Y367), R344 (= R370)
- binding D-glucose: F156 (= F182), Y210 (= Y236), W230 (= W256)
4xaiA Crystal structure of red flour beetle nr2e1/tlx (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 1:366/565 of 4xaiA
- binding alpha-D-glucopyranose: D14 (= D40), K15 (= K41), W62 (= W88), D65 (= D91), R66 (= R92), E111 (= E137), E153 (= E179), Y155 (= Y181), Y155 (= Y181), W230 (= W256), W340 (= W366)
Sites not aligning to the query:
4xajC Crystal structure of human nr2e1/tlx (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 1:366/568 of 4xajC
Sites not aligning to the query:
6k7fA Crystal structure of mbpholo-tim21 fusion protein with a 17-residue helical linker (see paper)
93% identity, 93% coverage: 27:394/396 of query aligns to 2:369/499 of 6k7fA
- binding alpha-D-glucopyranose: D15 (= D40), K16 (= K41), W63 (= W88), D66 (= D91), R67 (= R92), E112 (= E137), E154 (= E179), P155 (= P180), Y156 (= Y181), Y156 (= Y181), W231 (= W256), W341 (= W366)
5azaA Crystal structure of mbp-saglb fusion protein with a 20-residue spacer in the connector helix (see paper)
93% identity, 93% coverage: 27:394/396 of query aligns to 1:368/836 of 5azaA
- binding alpha-D-glucopyranose: D14 (= D40), K15 (= K41), W62 (= W88), D65 (= D91), R66 (= R92), E111 (= E137), E153 (= E179), P154 (= P180), Y155 (= Y181), Y155 (= Y181), W230 (= W256), W340 (= W366)
Sites not aligning to the query:
8h68A Crystal structure of caenorhabditis elegans nmad-1 in complex with nog and mg(ii) (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 1:366/624 of 8h68A
- binding alpha-D-glucopyranose: D14 (= D40), K15 (= K41), K42 (= K68), E44 (= E70), E44 (= E70), E45 (= E71), W62 (= W88), D65 (= D91), R66 (= R92), E111 (= E137), E153 (= E179), E153 (= E179), P154 (= P180), Y155 (= Y181), Y155 (= Y181), F156 (= F182), W230 (= W256), W340 (= W366), W340 (= W366), Y341 (= Y367), R344 (= R370), R344 (= R370)
- binding glycine: P271 (= P297), K273 (= K299), E274 (= E300)
Sites not aligning to the query:
4pqkB C-terminal domain of DNA binding protein (see paper)
93% identity, 93% coverage: 27:393/396 of query aligns to 1:367/479 of 4pqkB
- binding alpha-D-glucopyranose: D14 (= D40), K15 (= K41), E44 (= E70), E45 (= E71), W62 (= W88), D65 (= D91), R66 (= R92), E111 (= E137), E153 (= E179), E153 (= E179), P154 (= P180), Y155 (= Y181), W230 (= W256), W340 (= W366), W340 (= W366), Y341 (= Y367)
5z0rB Structural insight into the zika virus capsid encapsulating the viral genome (see paper)
93% identity, 93% coverage: 27:395/396 of query aligns to 2:370/445 of 5z0rB
6zhoA Crystal structure of a cgrp receptor ectodomain heterodimer with bound high affinity inhibitor (see paper)
93% identity, 93% coverage: 26:392/396 of query aligns to 2:368/577 of 6zhoA
- binding alpha-D-glucopyranose: D16 (= D40), K17 (= K41), W64 (= W88), D67 (= D91), R68 (= R92), E113 (= E137), E155 (= E179), P156 (= P180), Y157 (= Y181), W232 (= W256), W342 (= W366)
Sites not aligning to the query:
- binding ~{N}-[(2~{R})-3-(7-methyl-2~{H}-indazol-5-yl)-1-oxidanylidene-1-[[(2~{S})-1-oxidanylidene-3-piperidin-4-yl-1-(4-pyridin-4-ylpiperazin-1-yl)propan-2-yl]amino]propan-2-yl]-2-oxidanylidene-spiro[1~{H}-pyrido[2,3-d][1,3]oxazine-4,4'-piperidine]-1'-carboxamide: 421, 422, 425, 435, 465, 468, 498, 499, 519, 521, 548, 549, 551
7p0fA Crystal structure of a cgrp receptor ectodomain heterodimer bound to macrocyclic inhibitor htl0028125 (see paper)
93% identity, 93% coverage: 26:392/396 of query aligns to 2:368/553 of 7p0fA
- binding alpha-D-glucopyranose: D16 (= D40), K17 (= K41), W64 (= W88), D67 (= D91), R68 (= R92), E113 (= E137), E155 (= E179), P156 (= P180), Y157 (= Y181), Y157 (= Y181), W232 (= W256), W342 (= W366)
Sites not aligning to the query:
- binding (1S,10R,23E)-12-methyl-10-[(7-methyl-1H-indazol-5-yl)methyl]-15,18,21-trioxa-5,9,12,27,29-pentazapentacyclo[23.5.2.11,4.13,7.028,31]tetratriaconta-3(33),4,6,23,25(32),26,28(31)-heptaene-8,11,30-trione: 421, 422, 425, 435, 463, 466, 467, 495, 496, 497, 517, 544, 546, 547, 549
8ax7A Crystal structure of a cgrp receptor ectodomain heterodimer bound to macrocyclic inhibitor htl0031448 (see paper)
93% identity, 93% coverage: 26:392/396 of query aligns to 2:368/569 of 8ax7A
- binding alpha-D-glucopyranose: D16 (= D40), K17 (= K41), W64 (= W88), D67 (= D91), R68 (= R92), E113 (= E137), E155 (= E179), P156 (= P180), Y157 (= Y181), W232 (= W256), W342 (= W366)
Sites not aligning to the query:
- binding (1~{S},10~{R},20~{E})-10-[(1,7-dimethylindazol-5-yl)methyl]-12-methyl-15,18-dioxa-9,12,24,26-tetrazapentacyclo[20.5.2.1^{1,4}.1^{3,7}.0^{25,28}]hentriaconta-3(30),4,6,20,22,24,28-heptaene-8,11,27-trione: 425, 463, 495, 496, 497, 546, 547, 549
8ax6A Crystal structure of a cgrp receptor ectodomain heterodimer bound to macrocyclic inhibitor htl0029882 (see paper)
93% identity, 93% coverage: 26:392/396 of query aligns to 1:367/568 of 8ax6A
- binding alpha-D-glucopyranose: D15 (= D40), K16 (= K41), W63 (= W88), D66 (= D91), R67 (= R92), E112 (= E137), E154 (= E179), P155 (= P180), Y156 (= Y181), W231 (= W256), W341 (= W366)
Sites not aligning to the query:
- binding (1~{S},10~{R},20~{E})-12-methyl-10-[(7-methyl-2~{H}-indazol-5-yl)methyl]-15,18-dioxa-9,12,24,26-tetrazapentacyclo[20.5.2.1^{1,4}.1^{3,7}.0^{25,28}]hentriaconta-3(30),4,6,20,22,24,28-heptaene-8,11,27-trione: 421, 424, 462, 494, 495, 496, 543, 545, 546, 548
7p0iA Crystal structure of a cgrp receptor ectodomain heterodimer bound to macrocyclic inhibitor compound 13 (see paper)
93% identity, 93% coverage: 26:392/396 of query aligns to 2:368/571 of 7p0iA
- binding alpha-D-glucopyranose: D16 (= D40), K17 (= K41), W64 (= W88), D67 (= D91), R68 (= R92), E113 (= E137), E155 (= E179), P156 (= P180), Y157 (= Y181), W232 (= W256), M332 (= M356), W342 (= W366), R346 (= R370)
Sites not aligning to the query:
- binding (1S,20E)-10-(benzofuran-3-ylmethyl)-12-methyl-15,18-dioxa-5,9,12,24,26-pentazapentacyclo[20.5.2.11,4.13,7.025,28]hentriaconta-3(30),4,6,20,22(29),23,25(28)-heptaene-8,11,27-trione: 421, 422, 425, 435, 468, 471, 472, 496, 498, 545, 547, 548, 550
8qsoA Crystal structure of human mcl-1 in complex with compound 1 (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 2:367/518 of 8qsoA
Sites not aligning to the query:
- binding (13S,16R,19S)-16-benzyl-43-ethoxy-N-methyl-7,11,14,17-tetraoxo-13-phenyl-5-oxa-2,8,12,15,18-pentaaza-1(1,4),4(1,2)-dibenzena-9(1,4)-cyclohexanacycloicosaphane-19-carboxamide: 413, 421, 425, 447, 450, 457, 459, 460, 463, 515
8g3xA Mbp-mcl1 in complex with ligand 32 (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 2:367/518 of 8g3xA
- binding alpha-D-glucopyranose: D15 (= D40), K16 (= K41), W63 (= W88), D66 (= D91), R67 (= R92), E112 (= E137), E154 (= E179), E154 (= E179), P155 (= P180), Y156 (= Y181), Y156 (= Y181), W231 (= W256), W341 (= W366), R345 (= R370)
Sites not aligning to the query:
- binding N-[(1'S,3aS,5R,15S,17S,19Z,21R,21aR)-6'-chloro-20-fluoro-21-{[(5S,9aS)-hexahydropyrazino[2,1-c][1,4]oxazin-8(1H)-yl]methyl}-21-methoxy-17-methyl-13,15-dioxo-2,3,3',3a,4,4',13,16,17,18,21,21a-dodecahydro-2'H,6H,8H-15lambda~6~-spiro[10,12-(ethanediylidene)-15lambda~6~-furo[3,2-i][1,4]oxazepino[3,4-f][1,2,7]thiadiazacyclohexadecine-7,1'-naphthalen]-15-yl]-3-methoxy-1-methyl-1H-pyrazole-4-carboxamide: 421, 428, 446, 447, 450, 459, 460, 463, 464, 467
8g3wA Mbp-mcl1 in complex with ligand 28 (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 2:367/518 of 8g3wA
- binding alpha-D-glucopyranose: D15 (= D40), K16 (= K41), W63 (= W88), D66 (= D91), R67 (= R92), E112 (= E137), E154 (= E179), P155 (= P180), Y156 (= Y181), Y156 (= Y181), W231 (= W256), W341 (= W366)
Sites not aligning to the query:
- binding N-[(1'S,3aS,5R,15S,17S,19Z,21R,21aR)-6'-chloro-20-fluoro-21-methoxy-17-methyl-13,15-dioxo-2,3,3',3a,4,4',13,16,17,18,21,21a-dodecahydro-2'H,6H,8H-15lambda~6~-spiro[10,12-(ethanediylidene)-15lambda~6~-furo[3,2-i][1,4]oxazepino[3,4-f][1,2,7]thiadiazacyclohexadecine-7,1'-naphthalen]-15-yl]-3-methoxy-1-methyl-1H-pyrazole-4-carboxamide: 421, 447, 450, 459, 460, 463, 464, 467
8g3uA Mbp-mcl1 in complex with ligand 21 (see paper)
93% identity, 92% coverage: 27:392/396 of query aligns to 2:367/518 of 8g3uA
- binding alpha-D-glucopyranose: D15 (= D40), K16 (= K41), W63 (= W88), D66 (= D91), R67 (= R92), E112 (= E137), E154 (= E179), P155 (= P180), Y156 (= Y181), W231 (= W256), W341 (= W366)
Sites not aligning to the query:
- binding (1'S,3aS,5R,16R,17S,19Z,21R,21aR)-6'-chloro-20-fluoro-21-{[(5S,9aS)-hexahydropyrazino[2,1-c][1,4]oxazin-8(1H)-yl]methyl}-21-methoxy-16,17-dimethyl-2,3,3',3a,4',16,17,18,21,21a-decahydro-2'H,6H,8H-15lambda~6~-spiro[10,12-(ethanediylidene)-15lambda~6~-furo[3,2-i][1,4]oxazepino[3,4-f][1,2,7]thiadiazacyclohexadecine-7,1'-naphthalene]-13,15,15(4H,14H)-trione: 421, 424, 428, 446, 447, 450, 460, 463, 464, 467
Query Sequence
>BWI76_RS01830 FitnessBrowser__Koxy:BWI76_RS01830
MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VSVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEISPDKAFQDKLYPFTW
DAVRYNGKLIAYPVAVEALSLIYNKDLVPNPPKTWEEIPALDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKFENGKYDVKNVGVDSAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGNASKPFVGVLSAGINAASPNKE
LAKEFLENYLMTDQGLDEVNKDKPLGAVALKSFQEKLEKDPRIAATMANAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVEAALKDAQSRITK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory