SitesBLAST
Comparing BWI76_RS01920 FitnessBrowser__Koxy:BWI76_RS01920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2rjhA Crystal structure of biosynthetic alaine racemase in d-cycloserine- bound form from escherichia coli (see paper)
90% identity, 100% coverage: 1:359/359 of query aligns to 1:359/359 of 2rjhA
- active site: K34 (= K34), R129 (= R129), H159 (= H159), R209 (= R209), Y255 (= Y255), A302 (= A302), D304 (= D304)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K34 (= K34), Y38 (= Y38), R129 (= R129), H159 (= H159), A193 (= A193), S194 (= S194), R209 (= R209), G211 (= G211), I212 (= I212), Y255 (= Y255), A302 (= A302), M303 (= M303), Y343 (= Y343)
P0A6B4 Alanine racemase, biosynthetic; EC 5.1.1.1 from Escherichia coli (strain K12) (see paper)
90% identity, 100% coverage: 1:359/359 of query aligns to 1:359/359 of P0A6B4
- K34 (= K34) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K122) modified: N6-carboxylysine
- D164 (= D164) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- E165 (= E165) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- P219 (= P219) mutation to A: No effect on catalytic activity. No effect on affinity for D-Ala and L-Ala.
- E221 (≠ D221) mutation E->A,K,P: Slightly increases catalytic activity. Slightly increases affinity for D-Ala and L-Ala.
3b8tA Crystal structure of escherichia coli alaine racemase mutant p219a (see paper)
90% identity, 100% coverage: 1:359/359 of query aligns to 1:359/359 of 3b8tA
- active site: K34 (= K34), R129 (= R129), H159 (= H159), R209 (= R209), Y255 (= Y255), A302 (= A302), D304 (= D304)
- binding pyridoxal-5'-phosphate: V32 (= V32), K34 (= K34), Y38 (= Y38), L78 (= L78), H159 (= H159), A193 (= A193), S194 (= S194), R209 (= R209), G211 (= G211), I212 (= I212), Y343 (= Y343)
4xbjA Y274f alanine racemase from e. Coli inhibited by l-ala-p (see paper)
90% identity, 99% coverage: 3:359/359 of query aligns to 1:357/357 of 4xbjA
- active site: K32 (= K34), R127 (= R129), H157 (= H159), R207 (= R209), Y253 (= Y255), A300 (= A302), D302 (= D304)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: V30 (= V32), K32 (= K34), Y36 (= Y38), R127 (= R129), H157 (= H159), A191 (= A193), S192 (= S194), R207 (= R209), G209 (= G211), I210 (= I212), Y253 (= Y255), A300 (= A302), M301 (= M303), Y341 (= Y343)
6a2fA Crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa (see paper)
46% identity, 99% coverage: 1:357/359 of query aligns to 1:356/358 of 6a2fA
- active site: K34 (= K34), R130 (= R129), H159 (= H159), R209 (= R209), Y254 (= Y255), S301 (≠ A302), D303 (= D304)
- binding acetate ion: Y254 (= Y255), R279 (= R280), L340 (≠ S341), Y342 (= Y343)
- binding d-lysine: Y254 (= Y255), Y273 (= Y274), S301 (≠ A302), M302 (= M303), D303 (= D304), M304 (= M305)
- binding malonate ion: K123 (= K122), R130 (= R129), L131 (= L130)
Q9HTQ2 Alanine racemase, catabolic; EC 5.1.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
47% identity, 97% coverage: 1:349/359 of query aligns to 1:347/357 of Q9HTQ2
- K33 (= K34) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K122) modified: N6-carboxylysine
1rcqA The 1.45 a crystal structure of alanine racemase from a pathogenic bacterium, pseudomonas aeruginosa, contains both internal and external aldimine forms (see paper)
47% identity, 99% coverage: 1:357/359 of query aligns to 1:354/357 of 1rcqA
- active site: K33 (= K34), R129 (= R129), H158 (= H159), R208 (= R209), Y253 (= Y255), S300 (≠ A302), D302 (= D304)
- binding d-lysine: K33 (= K34), R129 (= R129), Y341 (= Y343)
- binding pyridoxal-5'-phosphate: V31 (= V32), K33 (= K34), Y37 (= Y38), H158 (= H159), N192 (≠ A193), S193 (= S194), R208 (= R209), G210 (= G211), I211 (= I212), Y341 (= Y343)
P9WQA9 Alanine racemase; EC 5.1.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 99% coverage: 4:357/359 of query aligns to 12:378/384 of P9WQA9
- K42 (= K34) modified: N6-(pyridoxal phosphate)lysine
6sczA Mycobacterium tuberculosis alanine racemase inhibited by dcs (see paper)
36% identity, 99% coverage: 4:357/359 of query aligns to 4:370/373 of 6sczA
- active site: K34 (= K34), R132 (= R129), H164 (= H159), R220 (= R209), Y263 (= Y255), C310 (≠ A302), D312 (= D304)
- binding (~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene-[(4~{R})-3-oxidanylidene-1,2-oxazolidin-4-yl]azanium: K34 (= K34), Y38 (= Y38), W80 (≠ L78), H164 (= H159), S205 (= S194), R220 (= R209), G222 (= G211), I223 (= I212), Y356 (= Y343)
- binding [2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methyl-(3-oxidanyl-1,2-oxazol-4-yl)azanium: Y38 (= Y38), W80 (≠ L78), H164 (= H159), N204 (≠ A193), S205 (= S194), R220 (= R209), G222 (= G211), I223 (= I212), Y263 (= Y255), Y282 (= Y274), M311 (= M303), Y356 (= Y343)
- binding polyethylene glycol: D172 (≠ E167), A210 (≠ L199), P212 (= P201)
5fagA Alanine racemase from streptomyces coelicolor a3(2) with bound propionate inhibitor (see paper)
38% identity, 98% coverage: 8:359/359 of query aligns to 19:389/390 of 5fagA
- active site: I19 (= I8), K45 (= K34), A46 (= A35), R147 (= R129), H180 (= H159), R236 (= R209), Y282 (= Y255), A329 (= A302), D331 (= D304)
- binding pyridoxal-5'-phosphate: K45 (= K34), Y49 (= Y38), W95 (≠ G80), W178 (≠ V157), H180 (= H159), N220 (≠ A193), S221 (= S194), R236 (= R209), G238 (= G211), I239 (= I212), Y373 (= Y343)
5fajA Alanine racemase from streptomyces coelicolor a3(2) in complex with d- cycloserine (see paper)
38% identity, 98% coverage: 8:359/359 of query aligns to 14:384/385 of 5fajA
- active site: I14 (= I8), K40 (= K34), A41 (= A35), R142 (= R129), H175 (= H159), R231 (= R209), Y277 (= Y255), A324 (= A302), D326 (= D304)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K40 (= K34), Y44 (= Y38), W90 (≠ G80), W173 (≠ V157), H175 (= H159), N215 (≠ A193), S216 (= S194), R231 (= R209), P232 (= P210), G233 (= G211), I234 (= I212), Y277 (= Y255), Y296 (= Y274), M325 (= M303), Y368 (= Y343)
1xfcA The 1.9 a crystal structure of alanine racemase from mycobacterium tuberculosis contains a conserved entryway into the active site (see paper)
35% identity, 99% coverage: 4:357/359 of query aligns to 2:363/366 of 1xfcA
- active site: K32 (= K34), R130 (= R129), H162 (= H159), R213 (= R209), C303 (≠ A302), D305 (= D304)
- binding pyridoxal-5'-phosphate: K32 (= K34), Y36 (= Y38), W78 (≠ L78), H162 (= H159), S198 (= S194), R213 (= R209), G215 (= G211), I216 (= I212), Y349 (= Y343)
1vfsA Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae (see paper)
38% identity, 98% coverage: 8:358/359 of query aligns to 10:374/383 of 1vfsA
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K36 (= K34), Y40 (= Y38), W82 (≠ F81), R134 (= R129), H166 (= H159), S207 (= S194), R222 (= R209), G224 (= G211), Y268 (= Y255), Y287 (= Y274), M316 (= M303), Y359 (= Y343)
1vfhA Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae (see paper)
38% identity, 98% coverage: 8:358/359 of query aligns to 10:374/382 of 1vfhA
- active site: K36 (= K34), R134 (= R129), H166 (= H159), R222 (= R209), Y268 (= Y255), A315 (= A302), D317 (= D304)
- binding pyridoxal-5'-phosphate: K36 (= K34), Y40 (= Y38), W82 (≠ F81), H166 (= H159), S207 (= S194), R222 (= R209), G224 (= G211), L225 (≠ I212), Y359 (= Y343)
6q70A Crystal structure of the alanine racemase bsu17640 from bacillus subtilis in the presence of hepes (see paper)
32% identity, 98% coverage: 8:358/359 of query aligns to 12:379/386 of 6q70A
- active site: K39 (= K34), R139 (= R129), H169 (= H159), R225 (= R209), Y272 (= Y255), T319 (≠ A302), D321 (= D304)
- binding pyridoxal-5'-phosphate: V37 (= V32), K39 (= K34), Y43 (= Y38), L85 (= L78), R139 (= R129), H169 (= H159), T210 (≠ S194), R225 (= R209), G227 (= G211), I228 (= I212), Y364 (= Y343)
5irpA Crystal structure of the alanine racemase bsu17640 from bacillus subtilis (see paper)
32% identity, 98% coverage: 8:358/359 of query aligns to 12:379/386 of 5irpA
- active site: K39 (= K34), R139 (= R129), H169 (= H159), R225 (= R209), Y272 (= Y255), T319 (≠ A302), D321 (= D304)
- binding magnesium ion: L155 (= L144), K156 (≠ S145), S158 (≠ C147), L161 (≠ V150)
- binding 2-amino-2-hydroxymethyl-propane-1,3-diol: D174 (= D164), P235 (= P219), Y364 (= Y343)
- binding (5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y43 (= Y38), L85 (= L78), R139 (= R129), H169 (= H159), N209 (≠ A193), T210 (≠ S194), R225 (= R209), G227 (= G211), I228 (= I212), Y364 (= Y343)
4y2wA Crystal structure of a thermostable alanine racemase from thermoanaerobacter tengcongensis mb4 (see paper)
31% identity, 96% coverage: 12:357/359 of query aligns to 17:374/388 of 4y2wA
- active site: K40 (= K34), R138 (= R129), H168 (= H159), R224 (= R209), Y268 (= Y255), C315 (≠ A302), D317 (= D304)
- binding alanine: Y268 (= Y255), Y287 (= Y274), C315 (≠ A302), M316 (= M303)
- binding phosphate ion: N208 (≠ A193), A209 (≠ S194), I227 (= I212)
3e6eA Crystal structure of alanine racemase from e.Faecalis complex with cycloserine (see paper)
33% identity, 97% coverage: 8:357/359 of query aligns to 12:369/370 of 3e6eA
- active site: K39 (= K34), R138 (= R129), H168 (= H159), R221 (= R209), Y266 (= Y255), C312 (≠ A302), D314 (= D304)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K39 (= K34), Y43 (= Y38), L85 (= L78), R138 (= R129), H168 (= H159), S206 (= S194), R221 (= R209), G223 (= G211), V224 (≠ I212), Y266 (= Y255), Y285 (= Y274), M313 (= M303), Y355 (= Y343)
3e5pB Crystal structure of alanine racemase from e.Faecalis (see paper)
33% identity, 97% coverage: 8:357/359 of query aligns to 13:370/371 of 3e5pB
- active site: K40 (= K34), R139 (= R129), H169 (= H159), R222 (= R209), Y267 (= Y255), C313 (≠ A302), D315 (= D304)
- binding pyridoxal-5'-phosphate: K40 (= K34), Y44 (= Y38), R139 (= R129), H169 (= H159), S207 (= S194), G224 (= G211), V225 (≠ I212), Y356 (= Y343)
6g58A Structure of the alanine racemase from staphylococcus aureus in complex with a pyridoxal 5' phosphate-derivative (see paper)
32% identity, 100% coverage: 2:359/359 of query aligns to 7:370/382 of 6g58A
- active site: K39 (= K34), R138 (= R129), H168 (= H159), R219 (= R209), Y265 (= Y255), C311 (≠ A302), D313 (= D304)
- binding (6-but-3-ynyl-4-methyl-5-oxidanyl-pyridin-3-yl)methyl dihydrogen phosphate: K39 (= K34), Y43 (= Y38), L85 (= L78), K131 (= K122), R138 (= R129), H168 (= H159), S204 (= S194), R219 (= R209), G221 (= G211), I222 (= I212), Y354 (= Y343)
Query Sequence
>BWI76_RS01920 FitnessBrowser__Koxy:BWI76_RS01920
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGIAQPILLLEGFFEAADLPVISTQRLHTAVHSPEQLAALEEADLPEPVTVW
MKLDTGMHRLGVLPEQAEAFYQRLSQCKNVRQPVNVVSHFARADEPECGATERQLDIFTT
FTEGKPGLRSIAASGGILLWPQSHFDWARPGIILYGVSPLDGGSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPEAQDKSGDPVVLWGEGLPVERIAAITKVSAYELITRLTSRVSMKYVD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory