Comparing BWI76_RS02105 FitnessBrowser__Koxy:BWI76_RS02105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
35% identity, 95% coverage: 2:418/437 of query aligns to 5:421/425 of O59010
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
35% identity, 94% coverage: 11:420/437 of query aligns to 9:420/424 of 6zl4A
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
35% identity, 94% coverage: 11:420/437 of query aligns to 10:421/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
34% identity, 96% coverage: 1:420/437 of query aligns to 2:423/427 of 5e9sA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
34% identity, 96% coverage: 1:420/437 of query aligns to 2:423/426 of 6xwnB
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
35% identity, 94% coverage: 2:413/437 of query aligns to 2:413/413 of 6x14A
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
35% identity, 94% coverage: 2:413/437 of query aligns to 5:416/419 of 6x15A
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
35% identity, 92% coverage: 13:413/437 of query aligns to 11:407/407 of 2nwwA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
35% identity, 95% coverage: 11:424/437 of query aligns to 5:416/416 of 6r7rA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 92% coverage: 11:413/437 of query aligns to 6:408/408 of 6bauA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
35% identity, 92% coverage: 11:413/437 of query aligns to 6:408/409 of 6bavA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
34% identity, 92% coverage: 11:413/437 of query aligns to 6:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 86% coverage: 46:420/437 of query aligns to 57:409/412 of 7awmA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 87% coverage: 46:426/437 of query aligns to 56:469/503 of Q10901
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 86% coverage: 46:420/437 of query aligns to 49:395/397 of 5mjuA
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 82% coverage: 46:405/437 of query aligns to 46:407/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 82% coverage: 46:405/437 of query aligns to 47:406/424 of 7xr6A
Sites not aligning to the query:
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
28% identity, 91% coverage: 16:414/437 of query aligns to 57:496/543 of P56564
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 82% coverage: 46:405/437 of query aligns to 82:488/573 of P31596
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
28% identity, 82% coverage: 46:405/437 of query aligns to 82:488/572 of P43006
Sites not aligning to the query:
>BWI76_RS02105 FitnessBrowser__Koxy:BWI76_RS02105
MKKKTKVSMAWQILLALVLGILLGSYLHYHAESRDWLISNLLTPAGDIFIHLIKMIVVPI
VISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIVLGITLANVFQPGSGIDMSQLAA
VDISKYQNTTAEVQSHAHGLMGTILSLVPTNIVASMAKGDMLPIIFFSVLFGLGLSSLPA
THREPLVTVFRSISETMFKVTHMVMRYAPVGVFALISVTVATFGFASLWPLAKLVILVYF
AILFFALVVLGIVARVCGLSIWTLIRILKDELILAYSTASSESVLPRIIEKMEAYGAPAS
ITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEITLVLTLMVTSKGIAGVPG
VSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKK
ALAYEREVLGKFDKTAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory