Comparing BWI76_RS02165 FitnessBrowser__Koxy:BWI76_RS02165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
97% identity, 93% coverage: 24:311/311 of query aligns to 1:288/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
97% identity, 93% coverage: 24:311/311 of query aligns to 1:288/288 of 1gudA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
93% identity, 93% coverage: 24:311/311 of query aligns to 1:288/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
93% identity, 93% coverage: 24:311/311 of query aligns to 1:288/288 of 8wl9A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
39% identity, 79% coverage: 28:272/311 of query aligns to 6:248/287 of 5dteB
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 91% coverage: 29:311/311 of query aligns to 5:270/274 of 2ioyA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
36% identity, 86% coverage: 28:295/311 of query aligns to 6:263/270 of 4zjpA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
36% identity, 91% coverage: 28:311/311 of query aligns to 5:270/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
32% identity, 85% coverage: 29:292/311 of query aligns to 13:263/284 of 7e7mC
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
30% identity, 92% coverage: 26:311/311 of query aligns to 2:277/290 of 4wutA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
33% identity, 85% coverage: 26:290/311 of query aligns to 10:269/296 of 4irxA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 87% coverage: 24:295/311 of query aligns to 6:267/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
27% identity, 87% coverage: 24:295/311 of query aligns to 1:262/278 of 6guqA
5xssA Xylfii molecule (see paper)
26% identity, 81% coverage: 35:285/311 of query aligns to 14:255/274 of 5xssA
Sites not aligning to the query:
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
28% identity, 85% coverage: 29:292/311 of query aligns to 9:269/295 of 4rxtA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
30% identity, 79% coverage: 28:272/311 of query aligns to 5:246/292 of 2fn8A
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 91% coverage: 29:311/311 of query aligns to 7:284/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 91% coverage: 29:311/311 of query aligns to 7:284/297 of 4ry9A
2rjoA Crystal structure of twin-arginine translocation pathway signal protein from burkholderia phytofirmans
27% identity, 91% coverage: 28:311/311 of query aligns to 7:291/322 of 2rjoA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
30% identity, 82% coverage: 36:290/311 of query aligns to 12:256/313 of 2h3hA
Sites not aligning to the query:
>BWI76_RS02165 FitnessBrowser__Koxy:BWI76_RS02165
MNKYLKIFSGTLMGVMLSTSAFAAADYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIF
ASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVAKAWKKGIYLVNLDEKIDMD
NLKKAGGNVEAFVTTDNVAVGAKGAAFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATE
AFKKASQIKLVASQPADWDRIKALDVATNVLQRNPNVKAIYCANDTMAMGVAQAVANAGK
TGKVLVVGTDGIPEARKMVEAGQMTATIAQNPADIGATGLKLMVDAEKSGKVIPLDKAPQ
FTLVDSILVTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory