Comparing BWI76_RS02250 FitnessBrowser__Koxy:BWI76_RS02250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 76% coverage: 39:419/500 of query aligns to 56:412/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 62% coverage: 81:388/500 of query aligns to 117:483/587 of P25297
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 66% coverage: 77:406/500 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 35% coverage: 81:257/500 of query aligns to 98:280/583 of Q9Y7Q9
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 47% coverage: 87:322/500 of query aligns to 78:316/452 of Q5EXK5
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 75% coverage: 16:392/500 of query aligns to 3:411/491 of P0AGF4
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 75% coverage: 19:392/500 of query aligns to 2:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 75% coverage: 19:392/500 of query aligns to 2:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 75% coverage: 19:392/500 of query aligns to 2:407/475 of 4gbyA
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 19% coverage: 73:168/500 of query aligns to 195:282/727 of Q9Z2I6
Sites not aligning to the query:
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
22% identity, 73% coverage: 81:446/500 of query aligns to 138:497/508 of 8bvtA
Sites not aligning to the query:
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
22% identity, 73% coverage: 81:446/500 of query aligns to 129:488/502 of 8bvsA
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
23% identity, 25% coverage: 81:206/500 of query aligns to 159:272/562 of O57379
Sites not aligning to the query:
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
22% identity, 73% coverage: 81:446/500 of query aligns to 129:484/497 of 8bw7A
>BWI76_RS02250 FitnessBrowser__Koxy:BWI76_RS02250
MLKRKKVKPITLRDVTIIDDSKLKKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPDAN
PSVQMIAALGTFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYA
TIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVMGA
GVVVLISSVVGEENFLSWGWRIPFFLALPLGIIGLYLRHALEETPAFQQHVDKMEQGDRE
GLQEGPKVSFKEIATKHWRSLLTCIGLVISTNVTYYMLLTYMPSYLSHNLHYSEDHGVLI
IIAIMVGMLFVQPVIGMLSDRFGRRPFILIGSVALFALSIPAFIMINSNVLGLIFAGLLV
LAVVLNCFIGVMASSLPAMFPTHIRFSALASAFNISVLIAGLTPTLAAWLVESTQNLMMP
AYYLMVIAVIGLITGLSMKETANRPLKGATPAASDIQEAKEILGEHYDNIEHKIEDIDQE
IADLQEKRSRLVQQHPRIND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory