Comparing BWI76_RS02800 FitnessBrowser__Koxy:BWI76_RS02800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
38% identity, 98% coverage: 7:497/500 of query aligns to 2:490/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 43% coverage: 8:221/500 of query aligns to 3:226/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 43% coverage: 8:221/500 of query aligns to 3:226/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 9:224/500 of query aligns to 2:215/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 43% coverage: 9:221/500 of query aligns to 4:216/280 of 5x40A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 17:224/500 of query aligns to 9:215/240 of 4ymuJ
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 48% coverage: 7:246/500 of query aligns to 2:231/285 of 4yerA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 60% coverage: 17:317/500 of query aligns to 14:300/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 14:221/500 of query aligns to 22:224/378 of P69874
Sites not aligning to the query:
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
31% identity, 43% coverage: 9:224/500 of query aligns to 2:217/220 of 8tzjA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
29% identity, 47% coverage: 9:245/500 of query aligns to 4:238/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
28% identity, 44% coverage: 8:225/500 of query aligns to 2:218/223 of 2pclA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 43% coverage: 9:224/500 of query aligns to 1:220/343 of P30750
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 9:225/500 of query aligns to 1:217/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
30% identity, 43% coverage: 9:225/500 of query aligns to 1:217/219 of 8w6iD
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
25% identity, 45% coverage: 8:232/500 of query aligns to 2:229/615 of 5lilA
>BWI76_RS02800 FitnessBrowser__Koxy:BWI76_RS02800
MNGEQHQEILRTEGLSKFFPGVKALDNVNFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGAIWLEGREISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPRRFGLLQRK
EMEKRATALMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VEMLFTLMRQLRDSGVSLIFVTHFLDQVYAVSDRITVLRNGGFVGCRETRELPQIELVKM
MLGRELEHNALQRAGRTLLSDKPVAAFEDFGKKGTIAPFNLQVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGKAWIKGKPQTLRSPHQASCLGIGFCPEDRKTDGIIAAASVRENIV
LALQAQRGWLRPISRREQNEIAERFIRQLGIRTPSAEQPIEFLSGGNQQKVLLSRWLLTK
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRQQ
VAELALSELSVPAIMNAIAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory