Comparing BWI76_RS03085 FitnessBrowser__Koxy:BWI76_RS03085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
26% identity, 52% coverage: 8:337/637 of query aligns to 2:313/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
26% identity, 51% coverage: 8:333/637 of query aligns to 1:308/311 of 2varA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
28% identity, 51% coverage: 10:332/637 of query aligns to 3:305/308 of 2dcnA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 51% coverage: 10:331/637 of query aligns to 3:296/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 51% coverage: 10:331/637 of query aligns to 2:295/302 of 3gbuA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
26% identity, 47% coverage: 35:332/637 of query aligns to 22:305/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
26% identity, 47% coverage: 35:332/637 of query aligns to 26:309/310 of 5yggA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 52% coverage: 8:340/637 of query aligns to 2:309/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
28% identity, 51% coverage: 8:332/637 of query aligns to 2:301/301 of 1v1aA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 51% coverage: 8:329/637 of query aligns to 2:298/300 of 1v1bA
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 50% coverage: 13:333/637 of query aligns to 10:308/319 of Q8ZKR2
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
25% identity, 50% coverage: 13:333/637 of query aligns to 6:297/297 of 1tz6A
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
25% identity, 50% coverage: 13:333/637 of query aligns to 6:297/299 of 1tz3A
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
25% identity, 50% coverage: 10:328/637 of query aligns to 5:313/322 of 3lkiB
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
25% identity, 44% coverage: 40:320/637 of query aligns to 57:315/338 of 3uboA
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
22% identity, 51% coverage: 10:334/637 of query aligns to 4:307/308 of 3iq0B
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
22% identity, 44% coverage: 54:333/637 of query aligns to 52:293/295 of 7aghA
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
22% identity, 44% coverage: 54:333/637 of query aligns to 52:295/302 of 7ag6A
Sites not aligning to the query:
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
22% identity, 44% coverage: 54:333/637 of query aligns to 52:295/298 of 7agkA
Sites not aligning to the query:
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
22% identity, 44% coverage: 54:333/637 of query aligns to 52:295/298 of P32143
Sites not aligning to the query:
>BWI76_RS03085 FitnessBrowser__Koxy:BWI76_RS03085
MNAAVKRLDVICIGRVAVDLYAQQIGARLEDVASFSKYLGGSSGNVAFGTAIQGLKSAML
ARVGDEHNGRFLRETLSRAGVDTEYLITDKQRLTALVMLGIKDQETFPLIFYRDNCADMA
LSPEDIKEEYIASSRALAVTGTHLSHANTREAVLKALEYARRHGLRTALDIDYRPVLWGL
TSLGDGETRFIESGQVTSQLQEVLHLFDLVVGTEEEFHIAGGSTDTLTALKNVRNATKAT
LVCKRGPMGCVVLEGAIPDNWDSVPLQQGVRVDVLNVLGAGDAFMSGLLRGWLNDEGWEQ
ACRYANACGALVVSRHGCAPAMPTKAELDDYLSRAESVPRPDIDDRLNHLHRVTSRRQAW
PELCIFAFDHRKQLADLALETGRDESCIPQLKLLLLAAAEAAADEAGLDGRSGILADGTY
GQRSLNAITGKGWWIGRPIEMPSSRPLRLEHGNIGSQLIDWPLEHVVKCLVFYHPADPAE
LRAEQDALLLEVWQACNKSGHELLLEIILPENGPDKDERHYHDMLEHFYQLGIQPDWWKL
PPLSSAEWERIGKLIAREDSWCRGILILGLDAPSDRLRAGFAEAAKHPMIKGFAVGRTIF
GQPSRRWMQGELSDEALINEVKRNYLTLIGYWREARG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory