SitesBLAST
Comparing BWI76_RS03110 FitnessBrowser__Koxy:BWI76_RS03110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
37% identity, 89% coverage: 40:481/499 of query aligns to 20:446/446 of A0A0H2VG78
- D22 (= D42) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R122) mutation to A: Loss of transport activity.
- I105 (≠ L125) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E142) mutation to A: Loss of transport activity.
- Q137 (≠ E157) mutation to A: Loss of transport activity.
- Q250 (= Q278) mutation to A: Loss of transport activity.
- Q251 (= Q279) mutation to A: Loss of transport activity.
- N256 (= N284) mutation to A: Loss of transport activity.
- W357 (= W392) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 89% coverage: 32:475/499 of query aligns to 38:482/509 of Q8VZR6
- ER 481:482 (≠ DK 474:475) mutation to AA: No effect on targeting.
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
31% identity, 92% coverage: 21:481/499 of query aligns to 6:487/491 of P0AGF4
- F24 (= F39) mutation to A: Decreases xylose transport.
- G83 (= G90) mutation to A: Abolishes xylose transport.
- R133 (= R122) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E142) mutation to A: Abolishes xylose transport.
- R160 (= R149) mutation to A: Abolishes xylose transport.
- Q168 (≠ E157) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q278) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 278:279) binding
- Q289 (= Q279) mutation to A: Strongly decreases xylose transport.
- N294 (= N284) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y288) mutation to A: Abolishes xylose transport.
- N325 (≠ S315) mutation to A: No effect on xylose transport.
- G340 (= G330) mutation to A: Abolishes xylose transport.
- R341 (= R331) mutation R->A,W: Abolishes xylose transport.
- W392 (= W392) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E397) mutation to A: Abolishes xylose transport.
- R404 (= R404) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ M415) binding
- W416 (= W416) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
32% identity, 90% coverage: 21:469/499 of query aligns to 2:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
32% identity, 90% coverage: 21:469/499 of query aligns to 2:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
32% identity, 90% coverage: 21:469/499 of query aligns to 2:471/475 of 4gbyA
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 68% coverage: 17:354/499 of query aligns to 20:363/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 66% coverage: 22:352/499 of query aligns to 24:363/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 90% coverage: 22:468/499 of query aligns to 22:485/514 of Q9LT15
- F39 (= F39) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ T43) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (≠ T63) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E142) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (≠ E157) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ Q164) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (= Q278) binding
- Q296 (= Q279) binding
- N301 (= N284) binding
- N332 (≠ S315) binding
- D344 (≠ G327) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W392) binding
- C449 (≠ A431) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
29% identity, 90% coverage: 22:468/499 of query aligns to 2:465/487 of 7aaqA
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
29% identity, 90% coverage: 18:468/499 of query aligns to 3:470/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ T43), I90 (≠ L85), H94 (≠ A89), V98 (≠ K93), F101 (≠ L96), N138 (≠ A133), P142 (= P137), N158 (≠ V153), F161 (≠ Q156), Q162 (≠ E157), I165 (= I160), D210 (= D207), G391 (≠ S388), P392 (= P389), W395 (= W392), M419 (≠ W416)
- binding beta-D-glucopyranose: Q280 (= Q278), N286 (= N284), M289 (= M287), G391 (≠ S388), W395 (= W392)
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 91% coverage: 24:476/499 of query aligns to 85:553/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
30% identity, 94% coverage: 22:489/499 of query aligns to 7:474/496 of P11169
- Q159 (≠ E157) binding
- QLS 277:279 (≠ AVI 275:277) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (= QQ 278:279) binding
- N286 (= N284) binding
- N315 (≠ S315) binding
- E378 (≠ Q384) binding
- W386 (= W392) binding
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
30% identity, 93% coverage: 22:484/499 of query aligns to 7:469/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (≠ E157), I166 (≠ Q164), Q280 (= Q278), Q281 (= Q279), N286 (= N284), F377 (≠ Q383), W386 (= W392)
- binding alpha-D-glucopyranose: Q159 (≠ E157), I162 (= I160), I166 (≠ Q164), Q280 (= Q278), Q281 (= Q279), N286 (= N284), W386 (= W392)
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
30% identity, 93% coverage: 22:484/499 of query aligns to 4:466/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F39), T25 (= T43), N29 (≠ S47), Q156 (≠ E157), I163 (≠ Q164), Q278 (= Q279), F286 (≠ M287), A308 (≠ N311), N312 (≠ S315), F374 (≠ Q383), E375 (≠ Q384), N406 (≠ M415), W407 (= W416), N410 (= N419)
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
30% identity, 93% coverage: 22:484/499 of query aligns to 5:467/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (= T43), A66 (vs. gap), S69 (≠ L72), Q157 (≠ E157), I164 (≠ Q164), Q278 (= Q278), Q279 (= Q279), N284 (= N284), N313 (≠ S315), F375 (≠ Q383), W384 (= W392), N411 (= N419), F412 (= F420), G415 (≠ S423)
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
29% identity, 94% coverage: 19:488/499 of query aligns to 4:473/493 of P32037
- N43 (≠ H58) modified: carbohydrate, N-linked (GlcNAc...) asparagine
W7MAT5 Myo-inositol transporter FST1 from Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) (see paper)
31% identity, 88% coverage: 32:469/499 of query aligns to 83:523/574 of W7MAT5
- IRG 276:278 (≠ TRH 228:230) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
- R277 (= R229) mutation R->G,K: Abolishes production of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
- VVS 295:297 (≠ LDE 245:247) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels.
- EEI 520:522 (≠ EQI 466:468) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
Sites not aligning to the query:
- 546:548 mutation Missing: Abolishes transporter activity. Strongly decreases synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels.
- 547 L→D: Decreases transporter activity. Moderately decreases synthesis of the polyketide mycotoxin fumonisin B1 (FB1).
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
30% identity, 93% coverage: 22:484/499 of query aligns to 7:469/470 of 7sptA
5c65A Structure of the human glucose transporter glut3 / slc2a3
30% identity, 93% coverage: 22:484/499 of query aligns to 3:457/457 of 5c65A
- binding Octyl Glucose Neopentyl Glycol : L42 (vs. gap), L58 (vs. gap), F75 (≠ L80), S76 (≠ L81), L79 (≠ N84), R87 (≠ K92), L95 (≠ V100), L96 (= L101), L121 (= L123), P199 (≠ M203)
- binding cholesterol hemisuccinate: I270 (= I272), S396 (= S414), T399 (≠ I417)
Query Sequence
>BWI76_RS03110 FitnessBrowser__Koxy:BWI76_RS03110
MSKEQYLTLNKASGPNSETPTTPFVKVVALIATLGGLLFGYDTGVISGALLFMGTELHLT
PFTTGLVTSSLLFGAAFGALLSGNLANAAGRKKIILWLAVLFAIGAIGTSMAPDVNWMIF
FRLILGVAVGGAAATVPVYIAEIAPANKRGQLVTLQELMIVSGQLLAYISNATFHEVWGG
ESTWRWMLAVATLPAVLLWFGMMFMPDSPRWYAMKGRLAEARRVLERTRHKDDVEWELLE
ITETLDEQRNLGKPRFSEIMTPWLFKLFMIGIGIAVIQQLTGVNTIMYYAPTVLTSVGMT
DNAALFATIANGVVSVLMTFVGIWMLGKIGRRPMTMIGQFGCTACLVFIGAVSYLLPETV
NGQPDALRAYMVLAGMLLFLSFQQGALSPVTWLLMSEIFPTRLRGIFMGGAVFSMWIANF
LISLFFPILLAWLGLSGTFFIFAGIGVFGAIFVIKCVPETRHRSLEQIEHYLRDKLDTSE
EGQAARARRIVAESQANKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory