SitesBLAST
Comparing BWI76_RS03120 BWI76_RS03120 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hprC Lpqy-sugabc in state 4 (see paper)
45% identity, 98% coverage: 2:350/356 of query aligns to 3:360/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F11), S38 (= S36), G39 (= G37), G41 (= G39), K42 (= K40), S43 (= S41), Q82 (= Q80), Q133 (≠ K131), G136 (= G134), G137 (= G135), Q138 (= Q136), H192 (= H190)
- binding magnesium ion: S43 (= S41), Q82 (= Q80)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
50% identity, 86% coverage: 2:308/356 of query aligns to 4:324/393 of P9WQI3
- H193 (= H190) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hprD Lpqy-sugabc in state 4 (see paper)
45% identity, 98% coverage: 2:350/356 of query aligns to 3:359/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F11), S38 (= S36), C40 (= C38), G41 (= G39), K42 (= K40), S43 (= S41), T44 (= T42), Q82 (= Q80), R129 (= R127), Q133 (≠ K131), S135 (= S133), G136 (= G134), G137 (= G135), Q159 (≠ E157), H192 (= H190)
- binding magnesium ion: S43 (= S41), Q82 (= Q80)
8hplC Lpqy-sugabc in state 1 (see paper)
48% identity, 86% coverage: 2:308/356 of query aligns to 3:321/384 of 8hplC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
45% identity, 98% coverage: 2:350/356 of query aligns to 7:374/375 of 2d62A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 3:354/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 3:354/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F11), S37 (= S36), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), Q81 (= Q80), R128 (= R127), A132 (≠ K131), S134 (= S133), G136 (= G135), Q137 (= Q136), E158 (= E157), H191 (= H190)
- binding magnesium ion: S42 (= S41), Q81 (= Q80)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 3:354/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F11), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), R128 (= R127), S134 (= S133), Q137 (= Q136)
- binding beryllium trifluoride ion: S37 (= S36), G38 (= G37), K41 (= K40), Q81 (= Q80), S134 (= S133), G136 (= G135), H191 (= H190)
- binding magnesium ion: S42 (= S41), Q81 (= Q80)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 3:354/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F11), V17 (≠ A16), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), R128 (= R127), A132 (≠ K131), S134 (= S133), Q137 (= Q136)
- binding tetrafluoroaluminate ion: S37 (= S36), G38 (= G37), K41 (= K40), Q81 (= Q80), S134 (= S133), G135 (= G134), G136 (= G135), E158 (= E157), H191 (= H190)
- binding magnesium ion: S42 (= S41), Q81 (= Q80)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 3:354/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F11), V17 (≠ A16), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), R128 (= R127), A132 (≠ K131), S134 (= S133), Q137 (= Q136)
- binding magnesium ion: S42 (= S41), Q81 (= Q80)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 96% coverage: 2:342/356 of query aligns to 4:355/371 of P68187
- A85 (= A83) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ E104) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V112) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V115) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ Q117) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ D122) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G135) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D156) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ L226) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ L239) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (vs. gap) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (vs. gap) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ W269) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (= G271) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (≠ N284) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (= E296) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (vs. gap) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (= G327) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
- G346 (= G333) mutation to S: Normal maltose transport but constitutive mal gene expression.
- F355 (= F342) mutation to Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 1:352/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F11), S35 (= S36), G36 (= G37), C37 (= C38), G38 (= G39), K39 (= K40), S40 (= S41), T41 (= T42), R126 (= R127), A130 (≠ K131), S132 (= S133), G134 (= G135), Q135 (= Q136)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 4:353/369 of P19566
- L86 (= L84) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P158) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D163) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (= E296) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1g291 Malk (see paper)
45% identity, 96% coverage: 2:342/356 of query aligns to 4:363/372 of 1g291
- binding magnesium ion: D69 (= D67), E71 (vs. gap), K72 (vs. gap), K79 (≠ R71), D80 (≠ E72), E292 (= E275), D293 (≠ H276), K359 (≠ D338)
- binding pyrophosphate 2-: S38 (= S36), G39 (= G37), C40 (= C38), G41 (= G39), K42 (= K40), T43 (≠ S41), T44 (= T42)
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
46% identity, 86% coverage: 2:307/356 of query aligns to 7:310/353 of 1vciA
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
43% identity, 96% coverage: 2:342/356 of query aligns to 3:324/344 of 2awnC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
50% identity, 67% coverage: 1:237/356 of query aligns to 17:253/378 of P69874
- C26 (≠ Q10) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F11) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F29) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C38) mutation to T: Loss of ATPase activity and transport.
- L60 (= L44) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L60) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ L119) mutation to M: Loss of ATPase activity and transport.
- D172 (= D156) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2awnA Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 96% coverage: 2:342/356 of query aligns to 3:312/330 of 2awnA
3d31A Modbc from methanosarcina acetivorans (see paper)
38% identity, 78% coverage: 1:278/356 of query aligns to 1:277/348 of 3d31A
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 77% coverage: 4:277/356 of query aligns to 6:281/353 of 1oxvD
Query Sequence
>BWI76_RS03120 BWI76_RS03120 ABC transporter ATP-binding protein
MLSLQNISKQFDGKPALSALSLDIREGEFVVLVGPSGCGKSTLLRLLAGLEPVSEGEIWL
HDENITDMSPRERNFAMIFQNYALFPHLSVRDNITFGMKVRKEEKTSWQPRVDKVAQMLQ
LDTLLDRKPAKLSGGQRQRVAMARAIVRNPRLFLMDEPLSNLDARLRSEVRDSIMDLHQQ
LRTSTVYVTHDQTEAMSMADRIVVMNGGHVQQVGRPEYLYANPANLFVAGFIGSPAMNLL
SLPCADGEVLLGELRYPLPPRYREESRVWLGIRPEHISDRVEENHLRLPATVLQRELMGA
DYLLHVSTPIGTLRFSRRHRGAVPEKGDSLILGFSPADVHLFHAEKQHNLAPVHQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory