SitesBLAST
Comparing BWI76_RS03140 FitnessBrowser__Koxy:BWI76_RS03140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bu2B Structure of alcohol dehydrogenase yjgb from escherichia coli (see paper)
85% identity, 99% coverage: 4:339/339 of query aligns to 2:337/339 of 7bu2B
7bu3A Structure of alcohol dehydrogenase yjgb in complex with NADP from escherichia coli (see paper)
85% identity, 99% coverage: 2:337/339 of query aligns to 1:336/336 of 7bu3A
- binding aspartic acid: S314 (= S315), A336 (= A337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C41), H41 (= H42), S42 (= S43), W51 (= W52), C151 (= C152), T155 (= T156), G175 (= G176), I176 (= I177), G177 (= G178), G178 (= G179), L179 (= L180), S198 (= S199), S199 (= S200), K203 (= K204), T237 (= T238), V238 (= V239), V240 (= V241), V260 (= V261), G261 (= G262), A285 (= A286), T286 (= T287), R331 (= R332)
- binding zinc ion: C40 (= C41), H62 (= H63), E63 (= E64), C95 (= C96), C98 (= C99), C101 (= C102), C109 (= C110), C151 (= C152)
6c49A Crystal structure of alcohol dehydrogenase from acinetobacter baumannii
60% identity, 100% coverage: 2:339/339 of query aligns to 2:336/338 of 6c49A
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 99% coverage: 1:335/339 of query aligns to 1:341/346 of P9WQC5
- K209 (≠ A203) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 99% coverage: 1:335/339 of query aligns to 1:342/349 of P0CH37
- K210 (≠ A203) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 99% coverage: 1:335/339 of query aligns to 1:342/349 of P0CH36
- K210 (≠ A203) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1yqdA Sinapyl alcohol dehydrogenase complexed with NADP+ (see paper)
36% identity, 97% coverage: 7:335/339 of query aligns to 13:348/359 of 1yqdA
- active site: C47 (= C41), H48 (= H42), S49 (= S43), H52 (≠ S46), H69 (= H63), E70 (= E64), C100 (= C96), C103 (= C99), C106 (= C102), C114 (≠ V115), I118 (= I119), C163 (= C152), T167 (= T156), R345 (= R332)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C47 (= C41), H48 (= H42), S49 (= S43), H52 (≠ S46), C163 (= C152), T167 (= T156), G188 (= G176), L189 (≠ I177), G190 (= G178), G191 (= G179), L192 (= L180), S211 (= S199), T212 (≠ S200), S213 (≠ N201), K216 (= K204), T251 (= T238), V252 (= V239), S253 (≠ A240), V274 (= V261), G275 (= G262), A276 (= A263), G299 (≠ A286), I300 (≠ T287), N340 (≠ G327), R345 (= R332)
- binding zinc ion: C47 (= C41), H69 (= H63), C100 (= C96), C103 (= C99), C106 (= C102), C114 (≠ V115), C163 (= C152)
6k3gB Crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with NADP+ (see paper)
39% identity, 97% coverage: 7:335/339 of query aligns to 13:348/356 of 6k3gB
- active site: C47 (= C41), S49 (= S43), H52 (≠ S46), H69 (= H63), C163 (= C152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H48 (= H42), S49 (= S43), H52 (≠ S46), W58 (= W52), C163 (= C152), T167 (= T156), G188 (= G176), L189 (≠ I177), G190 (= G178), G191 (= G179), L192 (= L180), S211 (= S199), T212 (≠ S200), S213 (≠ N201), K216 (= K204), T251 (= T238), V252 (= V239), S253 (≠ A240), A254 (≠ V241), V274 (= V261), G275 (= G262), A276 (= A263), A299 (= A286), I300 (≠ T287), R345 (= R332)
- binding zinc ion: C47 (= C41), H69 (= H63), C100 (= C96), C103 (= C99), C106 (= C102), C114 (≠ L111), C163 (= C152)
5vktA Cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) Moench (see paper)
35% identity, 98% coverage: 3:335/339 of query aligns to 2:343/353 of 5vktA
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ S46), H62 (= H63), E63 (= E64), C93 (= C96), C96 (= C99), C99 (= C102), C107 (= C110), V111 (≠ S114), C158 (= C152), T162 (= T156), R340 (= R332)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ S46), C158 (= C152), T162 (= T156), G183 (= G176), L184 (≠ I177), G185 (= G178), G186 (= G179), L187 (= L180), S206 (= S199), S207 (= S200), S208 (≠ N201), K211 (= K204), T246 (= T238), V247 (= V239), S248 (≠ A240), A249 (≠ V241), V269 (= V261), G270 (= G262), N293 (≠ S285), G294 (≠ A286), N335 (≠ G327), R340 (= R332)
- binding zinc ion: C40 (= C41), H62 (= H63), C93 (= C96), C96 (= C99), C99 (= C102), C107 (= C110), C158 (= C152)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
36% identity, 98% coverage: 3:335/339 of query aligns to 4:345/367 of 5z0cA
- active site: C44 (= C41), S46 (= S43), H49 (≠ S46), H66 (= H63), C160 (= C152)
- binding zinc ion: C44 (= C41), H66 (= H63), C97 (= C96), C100 (= C99), C103 (= C102), C111 (≠ V115), C160 (= C152)
1uufA Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
34% identity, 99% coverage: 1:335/339 of query aligns to 1:333/339 of 1uufA
- active site: C38 (= C41), H39 (= H42), S40 (= S43), H43 (≠ S46), H60 (= H63), E61 (= E64), C91 (= C96), C94 (= C99), C97 (= C102), C105 (≠ V108), T109 (≠ E112), C156 (= C152), T160 (= T156), R330 (= R332)
- binding zinc ion: C38 (= C41), H60 (= H63), C91 (= C96), C94 (= C99), C97 (= C102), C105 (≠ V108), C156 (= C152)
Sites not aligning to the query:
3twoB The crystal structure of cad from helicobacter pylori complexed with NADP(h) (see paper)
33% identity, 91% coverage: 28:335/339 of query aligns to 29:341/348 of 3twoB
- active site: C42 (= C41), H43 (= H42), S44 (= S43), H47 (≠ S46), H64 (= H63), E65 (= E64), C95 (= C96), C98 (= C99), C101 (= C102), C109 (vs. gap), V113 (vs. gap), C160 (= C152), T164 (= T156), R338 (= R332)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: C42 (= C41), H43 (= H42), S44 (= S43), H47 (≠ S46), C160 (= C152), T164 (= T156), G184 (= G176), F185 (≠ I177), G186 (= G178), G187 (= G179), L188 (= L180), R208 (≠ S200), T241 (= T238), I242 (≠ V239), P243 (≠ A240), T244 (≠ V241), V264 (= V261), G265 (= G262), L266 (≠ M265), L292 (≠ A286), I293 (≠ T287), L330 (≠ V324), G333 (= G327), R338 (= R332)
- binding zinc ion: C42 (= C41), H64 (= H63), C95 (= C96), C98 (= C99), C101 (= C102), C109 (vs. gap), C160 (= C152)
5fi3A Heteroyohimbine synthase thas1 from catharanthus roseus - complex with NADP+ (see paper)
34% identity, 97% coverage: 8:335/339 of query aligns to 10:336/344 of 5fi3A
- active site: C43 (= C41), Q44 (≠ H42), Y45 (≠ S43), E48 (≠ S46), H65 (= H63), E66 (= E64), C96 (= C96), C99 (= C99), C102 (= C102), C110 (= C110), G114 (= G113), C151 (= C152), R333 (= R332)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Q44 (≠ H42), E48 (≠ S46), T155 (= T156), G176 (= G176), L177 (≠ I177), G178 (= G178), G179 (= G179), L180 (= L180), S199 (= S199), S200 (= S200), K204 (= K204), T239 (= T238), I240 (≠ V239), P241 (≠ A240), L262 (≠ V261), G263 (= G262), T287 (≠ A286), S328 (≠ G327)
- binding zinc ion: C43 (= C41), H65 (= H63), E66 (= E64), C96 (= C96), C99 (= C99), C102 (= C102), C110 (= C110), C151 (= C152)
7cguA Crystal structure of abhar
34% identity, 98% coverage: 7:338/339 of query aligns to 7:346/352 of 7cguA
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
31% identity, 99% coverage: 4:338/339 of query aligns to 1:337/337 of P12311
- C38 (= C41) mutation to S: No activity.
- T40 (≠ S43) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ S46) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
30% identity, 98% coverage: 4:336/339 of query aligns to 1:335/336 of 6iqdA
- active site: C38 (= C41), T40 (≠ S43), H43 (≠ S46), H61 (= H63), C148 (= C152)
- binding zinc ion: C38 (= C41), H61 (= H63), E62 (= E64), C92 (= C96), C95 (= C99), C98 (= C102), C106 (= C110), C148 (= C152)
5h83A Heteroyohimbine synthase hys from catharanthus roseus - apo form (see paper)
34% identity, 97% coverage: 7:335/339 of query aligns to 14:345/354 of 5h83A
8a3nB Geissoschizine synthase from catharanthus roseus - binary complex with NADP+ (see paper)
33% identity, 91% coverage: 29:335/339 of query aligns to 32:343/352 of 8a3nB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N45 (≠ H42), V161 (≠ T156), G182 (= G176), L183 (≠ I177), L186 (= L180), S205 (= S199), T206 (≠ S200), K210 (= K204), T245 (= T238), P247 (vs. gap), V269 (= V261), A271 (= A263), S294 (≠ A286), L335 (≠ G327), R340 (= R332)
- binding zinc ion: C44 (= C41), H66 (= H63), E67 (= E64), C97 (= C96), C100 (= C99), C103 (= C102), C111 (= C110), C157 (= C152)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
31% identity, 98% coverage: 4:335/339 of query aligns to 1:334/339 of 1rjwA
- active site: C38 (= C41), H39 (= H42), T40 (≠ S43), H43 (≠ S46), H61 (= H63), E62 (= E64), C92 (= C96), C95 (= C99), C98 (= C102), C106 (= C110), K110 (≠ S114), C148 (= C152), T152 (= T156), R331 (= R332)
- binding trifluoroethanol: T40 (≠ S43), C148 (= C152), I285 (≠ A286)
- binding zinc ion: C38 (= C41), H61 (= H63), C92 (= C96), C95 (= C99), C98 (= C102), C106 (= C110)
8b1vA Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga (see paper)
31% identity, 94% coverage: 16:335/339 of query aligns to 23:349/358 of 8b1vA
Query Sequence
>BWI76_RS03140 FitnessBrowser__Koxy:BWI76_RS03140
MSTIKSYAAKEAGADLSLWEYDAGDLKPEDVEVQVEYCGICHSDLSMIDNEWGMSSYPLV
AGHEVIGRVAALGSAAQDKGLKVGQKVGIGWTARSCGHCDACISGNHVNCLEGSVPTIIN
RGGFADKLRADWQWVIPLPENVDLESAGPMLCGGITVFKPLLMHHVTANSRVGVIGIGGL
GHIAIKLLHAMGAEVTAFSSNPAKEQEVLAMGADRVVNSRDPEALKALAGQFDLIINTVA
VDLDWQPYFEALAYGGNFHTVGAVMKPFPVPAFTLIGGDRSISGSATGNPAELRKLMKFA
GRSKVAPTTELFPMSQINEALKHVREGKARYRVVLKADF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory