Comparing BWI76_RS03245 FitnessBrowser__Koxy:BWI76_RS03245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
39% identity, 58% coverage: 173:419/427 of query aligns to 259:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
39% identity, 56% coverage: 173:412/427 of query aligns to 244:488/490 of 4ki0F
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
26% identity, 67% coverage: 124:411/427 of query aligns to 6:272/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
23% identity, 53% coverage: 133:360/427 of query aligns to 37:254/313 of P94529
>BWI76_RS03245 FitnessBrowser__Koxy:BWI76_RS03245
MLLSEGKSMRIFPASFLIMGATQLISGHWIKGSVFLLFQIVVISNINLLLNATQGLITLG
TVAQTRSGFDIVAGDNSIFMLVEGVVAFIFLFFSIFVYWLNIKDAQVCEKCHQSFTEQLR
TIYDNRFATIMLAPAFIACIAFIIMPMIITVLVSLTNYSAPHHIPPKNLVDWVGLKNFIT
LFELRIWSKTFVGIGVWTVLWAFFATLCTCSFGFLLALALENKKIIAKKAWRVVFILPYA
IPAFVTLLIFRLLLNGIGPVNSTLNSWGIDSIGFLSDPLIAKMTVIAVSVWVGAPYFMLL
ITGAMTNIPRDLYEASEVDGASKFQQFREITLPMVLHQVAPSLVMTFAHNFNNFGAIYLL
TEGGPINPEYRFAGHTDILITWIYKLTLDFQQYQIASVISIIIFLFLSIFAIWQFRRMKS
FKEDVGM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory