SitesBLAST
Comparing BWI76_RS03320 BWI76_RS03320 alcohol dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
48% identity, 98% coverage: 6:349/352 of query aligns to 7:347/349 of P0CH37
- K210 (≠ A212) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
48% identity, 98% coverage: 6:349/352 of query aligns to 7:347/349 of P0CH36
- K210 (≠ A212) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 98% coverage: 6:349/352 of query aligns to 7:346/346 of P9WQC5
- K209 (≠ A212) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1uufA Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
51% identity, 97% coverage: 8:350/352 of query aligns to 6:339/339 of 1uufA
- active site: C38 (= C40), H39 (= H41), S40 (= S42), H43 (= H45), H60 (= H65), E61 (= E66), C91 (= C96), C94 (= C99), C97 (= C102), C105 (= C110), T109 (= T115), C156 (= C161), T160 (= T165), R330 (= R341)
- binding zinc ion: C38 (= C40), H60 (= H65), C91 (= C96), C94 (= C99), C97 (= C102), C105 (= C110), C156 (= C161), T339 (≠ S350)
6k3gB Crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with NADP+ (see paper)
48% identity, 99% coverage: 1:348/352 of query aligns to 8:352/356 of 6k3gB
- active site: C47 (= C40), S49 (= S42), H52 (= H45), H69 (= H65), C163 (= C161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H48 (= H41), S49 (= S42), H52 (= H45), W58 (= W51), C163 (= C161), T167 (= T165), G188 (= G185), L189 (≠ I186), G190 (= G187), G191 (= G188), L192 (= L189), S211 (≠ T208), T212 (≠ R209), S213 (≠ T210), K216 (= K213), T251 (= T247), V252 (≠ I248), S253 (≠ P249), A254 (≠ V250), V274 (= V270), G275 (= G271), A276 (= A272), A299 (≠ P295), I300 (≠ S296), R345 (= R341)
- binding zinc ion: C47 (= C40), H69 (= H65), C100 (= C96), C103 (= C99), C106 (= C102), C114 (= C110), C163 (= C161)
1yqdA Sinapyl alcohol dehydrogenase complexed with NADP+ (see paper)
43% identity, 99% coverage: 1:348/352 of query aligns to 8:352/359 of 1yqdA
- active site: C47 (= C40), H48 (= H41), S49 (= S42), H52 (= H45), H69 (= H65), E70 (= E66), C100 (= C96), C103 (= C99), C106 (= C102), C114 (= C110), I118 (≠ T115), C163 (= C161), T167 (= T165), R345 (= R341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C47 (= C40), H48 (= H41), S49 (= S42), H52 (= H45), C163 (= C161), T167 (= T165), G188 (= G185), L189 (≠ I186), G190 (= G187), G191 (= G188), L192 (= L189), S211 (≠ T208), T212 (≠ R209), S213 (≠ T210), K216 (= K213), T251 (= T247), V252 (≠ I248), S253 (≠ P249), V274 (= V270), G275 (= G271), A276 (= A272), G299 (≠ P295), I300 (≠ S296), N340 (≠ G336), R345 (= R341)
- binding zinc ion: C47 (= C40), H69 (= H65), C100 (= C96), C103 (= C99), C106 (= C102), C114 (= C110), C163 (= C161)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
43% identity, 100% coverage: 1:352/352 of query aligns to 5:354/367 of 5z0cA
- active site: C44 (= C40), S46 (= S42), H49 (= H45), H66 (= H65), C160 (= C161)
- binding zinc ion: C44 (= C40), H66 (= H65), C97 (= C96), C100 (= C99), C103 (= C102), C111 (= C110), C160 (= C161)
5vktA Cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) Moench (see paper)
43% identity, 97% coverage: 5:347/352 of query aligns to 5:346/353 of 5vktA
- active site: C40 (= C40), H41 (= H41), T42 (≠ S42), H45 (= H45), H62 (= H65), E63 (= E66), C93 (= C96), C96 (= C99), C99 (= C102), C107 (= C110), V111 (≠ P114), C158 (= C161), T162 (= T165), R340 (= R341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C40), H41 (= H41), T42 (≠ S42), H45 (= H45), C158 (= C161), T162 (= T165), G183 (= G185), L184 (≠ I186), G185 (= G187), G186 (= G188), L187 (= L189), S206 (≠ T208), S207 (≠ R209), S208 (≠ T210), K211 (= K213), T246 (= T247), V247 (≠ I248), S248 (≠ P249), A249 (≠ V250), V269 (= V270), G270 (= G271), N293 (≠ S294), G294 (≠ P295), N335 (≠ G336), R340 (= R341)
- binding zinc ion: C40 (= C40), H62 (= H65), C93 (= C96), C96 (= C99), C99 (= C102), C107 (= C110), C158 (= C161)
3twoB The crystal structure of cad from helicobacter pylori complexed with NADP(h) (see paper)
39% identity, 100% coverage: 1:351/352 of query aligns to 3:348/348 of 3twoB
- active site: C42 (= C40), H43 (= H41), S44 (= S42), H47 (= H45), H64 (= H65), E65 (= E66), C95 (= C96), C98 (= C99), C101 (= C102), C109 (= C110), V113 (≠ T115), C160 (= C161), T164 (= T165), R338 (= R341)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: C42 (= C40), H43 (= H41), S44 (= S42), H47 (= H45), C160 (= C161), T164 (= T165), G184 (= G185), F185 (≠ I186), G186 (= G187), G187 (= G188), L188 (= L189), R208 (= R209), T241 (= T247), I242 (= I248), P243 (= P249), T244 (≠ V250), V264 (= V270), G265 (= G271), L266 (vs. gap), L292 (≠ P295), I293 (≠ S296), L330 (≠ M333), G333 (= G336), R338 (= R341)
- binding zinc ion: C42 (= C40), H64 (= H65), C95 (= C96), C98 (= C99), C101 (= C102), C109 (= C110), C160 (= C161)
7cguA Crystal structure of abhar
43% identity, 98% coverage: 2:346/352 of query aligns to 3:345/352 of 7cguA
8b25B Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga - stemmadenine acetate bound structure (see paper)
43% identity, 98% coverage: 1:346/352 of query aligns to 8:351/359 of 8b25B
8b1vA Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga (see paper)
43% identity, 98% coverage: 1:346/352 of query aligns to 8:351/358 of 8b1vA
8a3nB Geissoschizine synthase from catharanthus roseus - binary complex with NADP+ (see paper)
40% identity, 99% coverage: 1:348/352 of query aligns to 5:347/352 of 8a3nB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N45 (≠ H41), V161 (≠ T165), G182 (= G185), L183 (≠ I186), L186 (= L189), S205 (≠ T208), T206 (≠ R209), K210 (= K213), T245 (= T247), P247 (= P249), V269 (= V270), A271 (= A272), S294 (≠ P295), L335 (≠ G336), R340 (= R341)
- binding zinc ion: C44 (= C40), H66 (= H65), E67 (= E66), C97 (= C96), C100 (= C99), C103 (= C102), C111 (= C110), C157 (= C161)
5h81B Heteroyohimbine synthase thas2 from catharanthus roseus - complex with NADP+ (see paper)
39% identity, 98% coverage: 1:346/352 of query aligns to 2:348/354 of 5h81B
- active site: A343 (≠ R341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V174 (≠ T165), F196 (≠ I186), G197 (= G187), R198 (≠ G188), I199 (≠ L189), S218 (≠ T208), T219 (≠ R209), S220 (≠ T210), K223 (= K213), V259 (≠ I248), P260 (= P249), L281 (≠ V270), I297 (≠ P295)
- binding zinc ion: C41 (= C40), H63 (= H65), E64 (= E66), C94 (= C96), C97 (= C99), C100 (= C102), C108 (= C110), C170 (= C161)
Q6ZHS4 Cinnamyl alcohol dehydrogenase 2; OsCAD2; Protein GOLD HULL AND INTERNODE 2; EC 1.1.1.195 from Oryza sativa subsp. japonica (Rice) (see paper)
43% identity, 97% coverage: 5:347/352 of query aligns to 12:351/363 of Q6ZHS4
- G185 (= G182) mutation to D: Loss of activity.
5h83A Heteroyohimbine synthase hys from catharanthus roseus - apo form (see paper)
39% identity, 99% coverage: 1:348/352 of query aligns to 9:349/354 of 5h83A
O49482 Cinnamyl alcohol dehydrogenase 5; AtCAD5; Cinnamyl alcohol dehydrogenase D; EC 1.1.1.195 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 98% coverage: 2:346/352 of query aligns to 9:350/357 of O49482
- C47 (= C40) binding
- T49 (≠ S42) binding
- H69 (= H65) binding
- E70 (= E66) binding ; mutation to A: Loss of activity.
- C100 (= C96) binding
- C103 (= C99) binding
- C106 (= C102) binding
- C114 (= C110) binding
- C163 (= C161) binding
- T167 (= T165) binding
- GLGGVG 188:193 (≠ GIGGLG 185:190) binding
- SSSNKK 211:216 (≠ TRTEAK 208:213) binding
- T251 (= T247) binding
- G275 (= G271) binding
- SFI 298:300 (≠ SPS 294:296) binding
2cf6A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases atcad5 (see paper)
42% identity, 98% coverage: 2:346/352 of query aligns to 4:345/352 of 2cf6A
- active site: C42 (= C40), H43 (= H41), T44 (≠ S42), H47 (= H45), H64 (= H65), E65 (= E66), C95 (= C96), C98 (= C99), C101 (= C102), C109 (= C110), I113 (≠ T117), C158 (= C161), T162 (= T165), R340 (= R341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H43 (= H41), T44 (≠ S42), T162 (= T165), L184 (≠ I186), G185 (= G187), G186 (= G188), V187 (≠ L189), S206 (≠ T208), S207 (≠ R209), K211 (= K213), T246 (= T247), M269 (≠ V270), S293 (= S294), F294 (≠ P295), I295 (≠ S296)
- binding zinc ion: C42 (= C40), H64 (= H65), E65 (= E66), C98 (= C99), C109 (= C110)
2cf5A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5 (see paper)
42% identity, 98% coverage: 2:346/352 of query aligns to 4:345/352 of 2cf5A
- active site: C42 (= C40), H43 (= H41), T44 (≠ S42), H47 (= H45), H64 (= H65), E65 (= E66), C95 (= C96), C98 (= C99), C101 (= C102), C109 (= C110), I113 (≠ T117), C158 (= C161), T162 (= T165), R340 (= R341)
- binding zinc ion: C42 (= C40), H64 (= H65), E65 (= E66), C95 (= C96), C98 (= C99), C101 (= C102), C109 (= C110), C158 (= C161)
5fi3A Heteroyohimbine synthase thas1 from catharanthus roseus - complex with NADP+ (see paper)
38% identity, 98% coverage: 1:346/352 of query aligns to 4:338/344 of 5fi3A
- active site: C43 (= C40), Q44 (≠ H41), Y45 (≠ S42), E48 (≠ H45), H65 (= H65), E66 (= E66), C96 (= C96), C99 (= C99), C102 (= C102), C110 (= C110), G114 (≠ P114), C151 (= C161), R333 (= R341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Q44 (≠ H41), E48 (≠ H45), T155 (= T165), G176 (= G185), L177 (≠ I186), G178 (= G187), G179 (= G188), L180 (= L189), S199 (≠ T208), S200 (≠ R209), K204 (= K213), T239 (= T247), I240 (= I248), P241 (= P249), L262 (≠ V270), G263 (= G271), T287 (≠ P295), S328 (≠ G336)
- binding zinc ion: C43 (= C40), H65 (= H65), E66 (= E66), C96 (= C96), C99 (= C99), C102 (= C102), C110 (= C110), C151 (= C161)
Query Sequence
>BWI76_RS03320 BWI76_RS03320 alcohol dehydrogenase
MKTFGYAAQNAQSGLAPMSFERRALRDDDLAIEINYCGVCHSDLHQIRDDWRSWNPTVYP
SIPGHEIIGTVIEVGPNVTHYKIGDAVAVGTIVDSCRVCDQCRRGEEQMCREFPTMTYNS
SDRHDGKTTLGGYSKHIIVREEFVLRMPEGLDAARAAPLLCAGITVYSPLRTWNVGPGSR
VGVIGIGGLGHLAVKFAAGLGAHVTVITRTEAKTAEARALGADTTLISNSDDAMKAATSS
FDVIIDTIPVEHDVSAYVQLLDVEGALVIVGALGNMAGFNSLPLIMGRRCITGSPSGGIA
ETQEMLDFCGKTGILPECEMIAIAEINEAFERMERGEVHYRFVIDMATLSDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory