Comparing BWI76_RS03425 FitnessBrowser__Koxy:BWI76_RS03425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
37% identity, 93% coverage: 9:290/303 of query aligns to 6:289/297 of 8u8wA
3lbcD D-sialic acid aldolase complexed with l-arabinose
35% identity, 94% coverage: 9:292/303 of query aligns to 5:282/296 of 3lbcD
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
35% identity, 94% coverage: 9:292/303 of query aligns to 2:279/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
35% identity, 94% coverage: 9:292/303 of query aligns to 2:279/292 of 1fdyA
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
35% identity, 94% coverage: 9:292/303 of query aligns to 10:287/302 of 2wpbA
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
35% identity, 94% coverage: 9:292/303 of query aligns to 5:282/296 of 4bwlC
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
35% identity, 94% coverage: 9:292/303 of query aligns to 7:284/299 of 4bwlA
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
32% identity, 88% coverage: 10:275/303 of query aligns to 2:268/288 of Q9S4K9
Q2G160 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
30% identity, 93% coverage: 9:290/303 of query aligns to 5:287/293 of Q2G160
4wozB Crystal structures of cdnal from clostridium difficile in complex with mannosamine
30% identity, 93% coverage: 10:291/303 of query aligns to 4:286/290 of 4wozB
4woqC Crystal structures of cdnal from clostridium difficile in complex with ketobutyric
30% identity, 93% coverage: 10:291/303 of query aligns to 4:286/290 of 4woqC
1f7bA Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
31% identity, 93% coverage: 9:290/303 of query aligns to 4:287/293 of 1f7bA
1f74A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid (see paper)
31% identity, 93% coverage: 9:290/303 of query aligns to 4:287/293 of 1f74A
4imfA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-acetylneuraminic acid (see paper)
31% identity, 91% coverage: 9:284/303 of query aligns to 3:279/292 of 4imfA
4imgA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid (see paper)
31% identity, 91% coverage: 9:284/303 of query aligns to 4:280/293 of 4imgA
5kzdA N-acetylneuraminate lyase from methicillin-resistant staphylococcus aureus with bound sialic acid alditol (see paper)
29% identity, 93% coverage: 9:290/303 of query aligns to 4:278/284 of 5kzdA
1f73A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol (see paper)
31% identity, 93% coverage: 9:290/303 of query aligns to 4:282/288 of 1f73A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
33% identity, 93% coverage: 8:289/303 of query aligns to 1:283/292 of Q07607
1f7bC Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
30% identity, 93% coverage: 9:290/303 of query aligns to 4:279/285 of 1f7bC
6rd1A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant in complex with sialic acid (see paper)
30% identity, 90% coverage: 9:280/303 of query aligns to 6:282/304 of 6rd1A
>BWI76_RS03425 FitnessBrowser__Koxy:BWI76_RS03425
MVSDKWQVFRGIISAVVTPMHADESVNYAALDALARAQLARGVEGFYCCGSSGEGPLLRF
DERRQVLATLVQSAGGRVPVIAHVGTPRTRDAVELAKHAEQDGASAVSLVPPYYYKYSRE
EIIAYYRRVLDAISIPVILYNIPQFTGVELDAQSADALLGDEQVLGVKHTSHNLYSLERM
IARYPEKVFFNGFDEIFLSSLAAGATATVGTTVNLQPELFLALRSAFQQGEIARAQRLQQ
QINEVVGQLVARGVFQSAKYLAAKETVDTGPTREPFVALTAVQKGELDDLYLRLRGYIAD
AGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory