Comparing BWI76_RS03830 FitnessBrowser__Koxy:BWI76_RS03830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6qyiB Structure of hpab from e.Coli in complex with fad (see paper)
95% identity, 100% coverage: 1:520/520 of query aligns to 1:520/520 of 6qyiB
6eb0C Structure of 4-hydroxyphenylacetate 3-monooxygenase (hpab), oxygenase component from escherichia coli (see paper)
95% identity, 100% coverage: 2:519/520 of query aligns to 1:518/518 of 6eb0C
6qyhB Structure of apo hpab from e.Coli (see paper)
93% identity, 100% coverage: 1:520/520 of query aligns to 1:512/512 of 6qyhB
6b1bA Structure of 4-hydroxyphenylacetate 3-monooxygenase (hpab), oxygenase component from escherichia coli mutant xs6 (apo enzyme) (see paper)
93% identity, 100% coverage: 2:520/520 of query aligns to 1:510/510 of 6b1bA
Q5SJP8 4-hydroxyphenylacetate 3-monooxygenase oxygenase component; 4-HPA 3-hydroxylase; 4-HPA 3-monooxygenase large component; EC 1.14.14.9 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 88% coverage: 15:470/520 of query aligns to 4:448/481 of Q5SJP8
2yyjA Crystal structure of the oxygenase component (hpab) of 4- hydroxyphenylacetate 3-monooxygenase complexed with fad and 4- hydroxyphenylacetate (see paper)
31% identity, 88% coverage: 15:470/520 of query aligns to 3:447/476 of 2yyjA
Sites not aligning to the query:
O87009 FADH(2)-dependent monooxygenase TftD; Chlorophenol-4-monooxygenase component 2; Two component enzyme D; EC 1.14.14.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
27% identity, 87% coverage: 15:464/520 of query aligns to 3:448/515 of O87009
7e8pD Crystal structure of a flavin-dependent monooxygenase hada wild type complexed with reduced fad and 4-nitrophenol (see paper)
24% identity, 90% coverage: 15:481/520 of query aligns to 4:467/482 of 7e8pD
6vjrA Oxygen tolerant archeal 4hydroxybutyrylcoa dehydratase (4hbd) from n. Maritimus
23% identity, 82% coverage: 15:442/520 of query aligns to 4:428/502 of 6vjrA
Sites not aligning to the query:
P55792 4-hydroxybutyryl-CoA dehydratase/vinylacetyl-CoA-Delta-isomerase; 4-BUDH; Gamma-aminobutyrate metabolism dehydratase/isomerase; EC 4.2.1.120; EC 5.3.3.3 from Clostridium aminobutyricum (see paper)
22% identity, 89% coverage: 14:476/520 of query aligns to 3:474/490 of P55792
1u8vA Crystal structure of 4-hydroxybutyryl-coa dehydratase from clostridium aminobutyricum: radical catalysis involving a [4fe-4s] cluster and flavin (see paper)
22% identity, 89% coverage: 14:476/520 of query aligns to 3:474/490 of 1u8vA
>BWI76_RS03830 FitnessBrowser__Koxy:BWI76_RS03830
MKPENFRADTKRPLTGEEYLKSLQDGREIYIYGERVKDVTTHPAFRNAAASVAQMYDALH
KPELQDTLCWGTDTGSGGYTHKFFRVAKSADDLRQQRDAIAEWSRLSYGWMGRTPDYKAA
FGCALGANPGFYGQFEQNARDWYTRIQETGLYFNHAIVNPPIDRHKPADEVKDVYIKLEK
ETDAGIIVSGAKVVATNSALTHYNMIGFGSAQVMGENPDFALMFVAPMDAEGVKLISRAS
YELVAGATGSPYDYPLSSRFDENDAILVMDNVLIPWENVLIYRDFDRCRRWTMEGGFARM
YPLQACVRLAVKLDFITALLKRSLECTGTLEFRGVQAELGEVVAWRNMFWALSDSMCAEA
TPWVNGAYLPDHAALQTYRVMAPMAYAKIKNIIERSVTSGLIYLPSSARDLNNPQINEYL
AKYVRGSNGMDHVERIKILKLMWDAIGSEFGGRHELYEINYSGSQDEIRLQCLRQAQSSG
NMDKMMAMVDRCLSEYDQNGWTVPHLHNNTDINMLDKLLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory