Comparing BWI76_RS03895 FitnessBrowser__Koxy:BWI76_RS03895 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
38% identity, 78% coverage: 20:121/130 of query aligns to 15:119/126 of 2b33B
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
35% identity, 79% coverage: 20:122/130 of query aligns to 15:119/124 of 7cd4A
Sites not aligning to the query:
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
32% identity, 78% coverage: 20:121/130 of query aligns to 15:121/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
32% identity, 78% coverage: 20:121/130 of query aligns to 15:121/127 of 2uykC
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
34% identity, 78% coverage: 20:121/130 of query aligns to 20:124/137 of P80601
Sites not aligning to the query:
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
32% identity, 78% coverage: 20:121/130 of query aligns to 18:122/128 of A0A1J1DL12
Sites not aligning to the query:
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
34% identity, 78% coverage: 20:121/130 of query aligns to 15:118/124 of 3k0tC
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 78% coverage: 20:121/130 of query aligns to 16:122/128 of Q7CP78
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
30% identity, 78% coverage: 20:121/130 of query aligns to 15:122/127 of 3vczB
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
28% identity, 83% coverage: 13:120/130 of query aligns to 10:120/128 of P0AFQ5
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
27% identity, 61% coverage: 20:98/130 of query aligns to 17:97/127 of 5v4dA
O30478 3-hydroxybenzoate synthase; EC 4.1.3.45 from Streptomyces hygroscopicus (see paper)
28% identity, 88% coverage: 4:117/130 of query aligns to 209:336/340 of O30478
Sites not aligning to the query:
5ag3A Chorismatase mechanisms reveal fundamentally different types of reaction in a single conserved protein fold (see paper)
28% identity, 88% coverage: 4:117/130 of query aligns to 202:329/333 of 5ag3A
Sites not aligning to the query:
>BWI76_RS03895 FitnessBrowser__Koxy:BWI76_RS03895
MSIKRYGVEGGTGTGGQHLPFARAVEAGGWLYVSGQTPMKDGEVVEGGIVEQSRLAIQNC
VDIMNEAGYSLADVVHVKVILTDSRYFQSFNKVFREFFADNPPARICCVADLVVDCKVEV
DVTCYNAARV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory