Comparing BWI76_RS03910 BWI76_RS03910 2-dehydro-3-deoxy-6-phosphogalactonate aldolase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
70% identity, 98% coverage: 3:198/200 of query aligns to 6:201/205 of Q6BF16
2v82A Kdpgal complexed to kdpgal (see paper)
70% identity, 98% coverage: 3:198/200 of query aligns to 5:200/205 of 2v82A
Sites not aligning to the query:
1wa3D Mechanism of the class i kdpg aldolase (see paper)
32% identity, 99% coverage: 1:198/200 of query aligns to 6:200/203 of 1wa3D
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
28% identity, 70% coverage: 25:163/200 of query aligns to 36:173/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 70% coverage: 25:163/200 of query aligns to 36:173/213 of P0A955
Sites not aligning to the query:
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
29% identity, 84% coverage: 25:191/200 of query aligns to 33:209/216 of 3vcrA
1wauA Structure of kdpg aldolase e45n mutant (see paper)
28% identity, 70% coverage: 25:163/200 of query aligns to 36:173/213 of 1wauA
Sites not aligning to the query:
2c0aB Mechanism of the class i kdpg aldolase (see paper)
28% identity, 70% coverage: 25:163/200 of query aligns to 37:174/214 of 2c0aB
Sites not aligning to the query:
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
29% identity, 82% coverage: 1:164/200 of query aligns to 2:170/209 of 5xsfA
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
25% identity, 73% coverage: 25:169/200 of query aligns to 33:179/210 of 6oviA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
27% identity, 74% coverage: 25:171/200 of query aligns to 48:196/226 of P00885
Sites not aligning to the query:
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
27% identity, 70% coverage: 25:163/200 of query aligns to 38:175/216 of 1mxsA
>BWI76_RS03910 BWI76_RS03910 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
MDKIKLVAILRGIRPAEAAEHIATLVGAGFRYIEIPLNSPDWRQSIPQMVARFGEQAMIG
AGTVLKVEQVDFLADAGAKLIVTPNTQPEVIRRAVARGMRVCAGCATATEAFSALDAGAQ
WLKIFPSSAFGPDYIRALKAVLPPEVPVLAVGGVTPENLASWVRAGCAGAGLGSDLYRAG
QAVERTRQQAERFIAAARCG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory