Comparing BWI76_RS03965 FitnessBrowser__Koxy:BWI76_RS03965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P69801 PTS system mannose-specific EIIC component; EII-P-Man; EIIC-Man; Mannose permease IIC component from Escherichia coli (strain K12) (see paper)
28% identity, 99% coverage: 3:258/259 of query aligns to 7:263/266 of P69801
7dyrY Cryoem structure of mannose transporter manyz and microcin e492 (mcea) complex (see paper)
29% identity, 93% coverage: 3:244/259 of query aligns to 7:244/248 of 7dyrY
7vlxY Cryo-em structures of listeria monocytogenes man-pts (see paper)
25% identity, 92% coverage: 2:240/259 of query aligns to 4:244/247 of 7vlxY
8hfsY The structure of lcna, lcia, and the man-pts of lactococcus lactis (see paper)
30% identity, 88% coverage: 11:239/259 of query aligns to 15:247/249 of 8hfsY
7xtgD Cryo-em structure of listeria monocytogenes man-pts complexed with pediocin pa-1 (see paper)
27% identity, 93% coverage: 2:242/259 of query aligns to 5:247/248 of 7xtgD
>BWI76_RS03965 FitnessBrowser__Koxy:BWI76_RS03965
MVEALLLGLVAFIAQSEYALGTSLISRPIVTGLLTGLVLGDVQTGVIMGATLELAFIGSF
SVGASIPPDVVTGGILGVAFAITSGAGTETALLLGLPIATLTLILKNVYLGMFIPMLSQK
ADGYAERADTRGIERMHLIAGFGLSLMLATVVTVSFLVGSNAVKSLLDTIPEFIKHGLSV
ATGIIPALGFAMLARLLINKKVAPYFFLGFVLMAYLKIPVTGIAILGAIVAVVMVNVTAL
SSPRTTTEQGVSDDDEDDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory