Comparing BWI76_RS03970 FitnessBrowser__Koxy:BWI76_RS03970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7dyrZ Cryoem structure of mannose transporter manyz and microcin e492 (mcea) complex (see paper)
39% identity, 94% coverage: 18:282/283 of query aligns to 1:271/274 of 7dyrZ
8hfsZ The structure of lcna, lcia, and the man-pts of lactococcus lactis (see paper)
38% identity, 89% coverage: 27:279/283 of query aligns to 10:299/303 of 8hfsZ
7vlxZ Cryo-em structures of listeria monocytogenes man-pts (see paper)
44% identity, 70% coverage: 20:218/283 of query aligns to 1:198/298 of 7vlxZ
7xnoZ Cryo-em structure of the bacteriocin-receptor-immunity ternary complex from lactobacillus sakei (see paper)
33% identity, 92% coverage: 17:276/283 of query aligns to 1:294/301 of 7xnoZ
>BWI76_RS03970 FitnessBrowser__Koxy:BWI76_RS03970
MTTKMISEETLRPQEQEETRITPRDLRRVFWRSFQMEFSWNYERQMNLAFVYALIPVLKK
LYPRKEELAAALKRHLVFFNTTPHIVTLLLGITTAMEEKNSQQKNMDANAIDNVKASLMG
PLAGLGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLVFNVPHILVRWFFTRWGYVLG
TGVLQRIQKSGMMESLTYGASIIGLMVVGAMTASMIDITIPVSFGAGEAKTQVQDIINDI
LPCMLPLLSFGIVYWLLGRKVKPLSIIGGMALVGILGSWIGLF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory