SitesBLAST
Comparing BWI76_RS04145 FitnessBrowser__Koxy:BWI76_RS04145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ABP8 Purine nucleoside phosphorylase DeoD-type; PNP; EC 2.4.2.1 from Escherichia coli (strain K12) (see 5 papers)
94% identity, 100% coverage: 1:240/240 of query aligns to 1:239/239 of P0ABP8
- M1 (= M1) modified: Initiator methionine, Removed
- G21 (= G21) binding in other chain
- R25 (= R25) binding in other chain; mutation to A: Severe loss of catalytic activity. 20-fold decrease in affinity for phosphate.
- K27 (= K27) modified: N6-acetyllysine
- R44 (= R44) binding
- RVGS 88:91 (= RVGS 88:91) binding in other chain
- D205 (= D206) active site, Proton donor; mutation D->A,N: Severe loss of catalytic activity.
- R218 (= R219) Important for catalytic activity; mutation to A: Severe loss of catalytic activity.
P0ABP9 Purine nucleoside phosphorylase DeoD-type; PNP; EC 2.4.2.1 from Escherichia coli O157:H7 (see paper)
94% identity, 100% coverage: 1:240/240 of query aligns to 1:239/239 of P0ABP9
- H5 (= H5) binding
- G21 (= G21) binding in other chain
- R25 (= R25) binding in other chain
- R44 (= R44) binding
- RVGS 88:91 (= RVGS 88:91) binding in other chain
- EME 180:182 (= EME 181:183) binding in other chain
- SD 204:205 (= SD 205:206) binding in other chain
5iu6A Crystal structure of e.Coli purine nucleoside phosphorylase with 7- deazahypoxanthine (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 5iu6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 7H-pyrrolo[2,3-d]pyrimidin-4-ol: C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V180), E179 (= E181)
5i3cA Crystal structure of e.Coli purine nucleoside phosphorylase with acycloguanosine (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 5i3cA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 9-hyroxyethoxymethylguanine: S90 (= S91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V180), E179 (= E181), I206 (= I208)
- binding sulfate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (= S91)
3ut6A Crystal structure of e. Coli pnp complexed with po4 and formycin a (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 3ut6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: M64 (= M65), S90 (= S91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206)
- binding phosphate ion: G20 (= G21), R24 (= R25), R87 (= R88), G89 (= G90), S90 (= S91)
1pw7A Crystal structure of e. Coli purine nucleoside phosphorylase complexed with 9-beta-d-arabinofuranosyladenine and sulfate/phosphate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1pw7A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding phosphate ion: G20 (= G21), R87 (= R88), S90 (= S91)
- binding 2-(6-amino-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: S90 (= S91), C91 (= C92), F159 (= F160), E179 (= E181), E181 (= E183), S203 (= S205)
1pr0A Escherichia coli purine nucleoside phosphorylase complexed with inosine and phosphate/sulfate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1pr0A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding inosine: R87 (= R88), S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206)
- binding phosphate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (= S91)
1pkeA Crystal structure of e. Coli purine nucleoside phosphorylase complexed with 2-fluoro-2'-deoxyadenosine and sulfate/phosphate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1pkeA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208)
- binding 5-(6-amino-2-fluoro-purin-9-yl)-2-hydroxymethyl-tetrahydro-furan-3-ol: S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206)
- binding phosphate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (= S91)
1pk9A Crystal structure of e. Coli purine nucleoside phosphorylase complexed with 2-fluoroadenosine and sulfate/phosphate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1pk9A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 2-(6-amino-2-fluoro-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206)
- binding phosphate ion: G20 (= G21), R87 (= R88), S90 (= S91)
1pk7A Crystal structure of e. Coli purine nucleoside phosphorylase complexed with adenosine and sulfate/phosphate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1pk7A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding adenosine: M64 (= M65), S90 (= S91), C91 (= C92), F159 (= F160), M180 (= M182), E181 (= E183), D204 (= D206)
- binding phosphate ion: G20 (= G21), R87 (= R88)
1otyA Native pnp +allo (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1otyA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 6-methylpurine: G92 (= G93), F159 (= F160), V178 (= V180), M180 (= M182)
1k9sD Purine nucleoside phosphorylase from e. Coli in complex with formycin a derivative and phosphate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1k9sD
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 2-hydroxymethyl-5-(7-methylamino-3h-pyrazolo[4,3-d]pyrimidin-3-yl)-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (= S91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206), I206 (= I208)
- binding 2-(7-amino-6-methyl-3h-pyrazolo[4,3-d]pyrimidin-3-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: H4 (= H5), R43 (= R44)
- binding phosphate ion: G20 (= G21), R24 (= R25), R87 (= R88), G89 (= G90), S90 (= S91)
1k9sA Purine nucleoside phosphorylase from e. Coli in complex with formycin a derivative and phosphate (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1k9sA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 2-(7-amino-6-methyl-3h-pyrazolo[4,3-d]pyrimidin-3-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (= S91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), S203 (= S205)
- binding phosphate ion: G20 (= G21), R24 (= R25), R87 (= R88), G89 (= G90), S90 (= S91)
1a69A Purine nucleoside phosphorylase in complex with formycin b and sulphate (phosphate) (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1a69A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding formycin b: M64 (= M65), S90 (= S91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206)
1ovgA M64v pnp +mepdr (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1ovgA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 9-(2-deoxy-beta-d-ribofuranosyl)-6-methylpurine: S90 (= S91), F159 (= F160), V178 (= V180)
1ov6A M64v pnp + allo (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1ov6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 9-(6-deoxy-beta-d-allofuranosyl)-6-methylpurine: S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), S203 (= S205)
1oumA M64v pnp +talo (see paper)
94% identity, 99% coverage: 2:239/240 of query aligns to 1:237/237 of 1oumA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 9-(6-deoxy-alpha-l-talofuranosyl)-6-methylpurine: D21 (= D22), S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), M180 (= M182), E181 (= E183)
3occF Crystal structure of pnp with dadmeimmh from yersinia pseudotuberculosis
92% identity, 99% coverage: 2:239/240 of query aligns to 1:237/238 of 3occF
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R217 (= R219)
- binding 7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one: H4 (= H5), R43 (= R44), M64 (= M65), S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183), D204 (= D206), I206 (= I208)
1pr6A Escherichia coli purine nucleoside phosphorylase complexed with 9- beta-d-xylofuranosyladenine and phosphate/sulfate (see paper)
93% identity, 99% coverage: 2:239/240 of query aligns to 1:234/234 of 1pr6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208)
- binding phosphate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (= S91)
- binding 2-(6-amino-octahydro-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183)
1pr4A Escherichia coli purine nucleoside phosphorylase complexed with 9- beta-d-ribofuranosyl-6-methylthiopurine and phosphate/sulfate (see paper)
92% identity, 99% coverage: 2:239/240 of query aligns to 1:232/232 of 1pr4A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (= S91), S203 (= S205), D204 (= D206), I206 (= I208), R212 (= R219)
- binding 2-hydroxymethyl-5-(6-methylsulfanyl-purin-9-yl)-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (= S91), C91 (= C92), F159 (= F160), V178 (= V180), E179 (= E181), M180 (= M182), E181 (= E183)
- binding phosphate ion: G20 (= G21), R87 (= R88), S90 (= S91)
Query Sequence
>BWI76_RS04145 FitnessBrowser__Koxy:BWI76_RS04145
MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISV
MGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRMR
FKDHDFAAIADFGMVRNAVDAAKALGVDARVGNIFSADLFYAPDGGEMFDVMEKYGILGV
EMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTSSAERQTTFNDMIKIALESVLLGDKE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory