Comparing BWI76_RS04245 FitnessBrowser__Koxy:BWI76_RS04245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 99% coverage: 3:816/820 of query aligns to 91:911/916 of O81852
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
37% identity, 55% coverage: 3:457/820 of query aligns to 3:459/464 of 2hmfA
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
37% identity, 55% coverage: 3:457/820 of query aligns to 3:454/458 of 3c1nA
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
37% identity, 55% coverage: 3:457/820 of query aligns to 3:463/468 of 3c1mC
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 43% coverage: 466:815/820 of query aligns to 8:366/376 of O94671
2cdqA Crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine (see paper)
31% identity, 57% coverage: 3:470/820 of query aligns to 6:469/470 of 2cdqA
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 40% coverage: 464:793/820 of query aligns to 4:335/359 of P31116
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
33% identity, 40% coverage: 464:793/820 of query aligns to 3:334/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
33% identity, 40% coverage: 464:793/820 of query aligns to 3:334/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
33% identity, 40% coverage: 464:793/820 of query aligns to 3:334/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
33% identity, 40% coverage: 464:793/820 of query aligns to 3:334/358 of 1ebfA
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 57% coverage: 3:468/820 of query aligns to 17:503/519 of O60163
P08660 Lysine-sensitive aspartokinase 3; Aspartate kinase III; AKIII; Lysine-sensitive aspartokinase III; EC 2.7.2.4 from Escherichia coli (strain K12) (see paper)
30% identity, 56% coverage: 3:460/820 of query aligns to 6:448/449 of P08660
2j0xA Crystal structure of e. Coli aspartokinase iii in complex with lysine and aspartate (t-state) (see paper)
30% identity, 56% coverage: 3:460/820 of query aligns to 4:446/447 of 2j0xA
2j0wA Crystal structure of e. Coli aspartokinase iii in complex with aspartate and adp (r-state) (see paper)
30% identity, 56% coverage: 3:460/820 of query aligns to 4:446/447 of 2j0wA
3tviE Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
27% identity, 55% coverage: 3:457/820 of query aligns to 5:434/439 of 3tviE
3tviA Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
27% identity, 55% coverage: 3:457/820 of query aligns to 3:426/429 of 3tviA
5yeiC Mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase (see paper)
30% identity, 41% coverage: 122:456/820 of query aligns to 68:390/397 of 5yeiC
P26512 Aspartokinase; Aspartate kinase; EC 2.7.2.4 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see 2 papers)
32% identity, 41% coverage: 122:459/820 of query aligns to 69:405/421 of P26512
3aawC Crystal structure of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine (see paper)
33% identity, 39% coverage: 141:459/820 of query aligns to 75:388/392 of 3aawC
Sites not aligning to the query:
>BWI76_RS04245 FitnessBrowser__Koxy:BWI76_RS04245
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LTNIADAERIFAELLQGLADAQPGFPLAQLKAFVEQEFAQIKHVLHGISLLGQCPDSVNA
SLICRGEKLSIAIMAGLLEARGHNVTVINPVEKLLAVGHYLESTVDIAESTRRIAASQIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDDLPVKGISNLNNMAMFNVSGPGMKGMVGMAARVFATMSRAGISVVLITQSSSEYSISF
CVPQSDCARAKRVMEDEFYLELKEGLLEPLSIMERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVSNDDATTGVRVTHQMLFNTDQVIEVFVIGIGGVGGAL
IEQIKRQQSWLKSKHIDLRVCGVANSRALLTNVHGLNLEHWRDELAEAKEAFNLGRLIRL
VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSSLDYYHQLRHAASSSR
RKFLYDTNVGAGLPVIENLQNLLNAGDELLRFSGILSGSLSFIFGKLDEGVSFSEATRLA
REMGYTEPDPRDDLSGVDVARKLLILARETGRELELSDIIVEPALPAGFDASGDVDSFMA
RLPSLDDEFASRVAKARDEGKVLRYVGNIEEDGTCRVKIAAVDGNDPLFKVKNGENALAF
YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory