Comparing BWI76_RS04280 FitnessBrowser__Koxy:BWI76_RS04280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 57% coverage: 11:259/436 of query aligns to 61:319/587 of P25297
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 50% coverage: 8:225/436 of query aligns to 34:259/583 of Q9Y7Q9
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 52% coverage: 53:277/436 of query aligns to 47:250/403 of P77589
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 70% coverage: 81:384/436 of query aligns to 82:398/452 of Q5EXK5
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
25% identity, 84% coverage: 6:371/436 of query aligns to 21:392/448 of Q51955
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 38% coverage: 30:196/436 of query aligns to 50:204/444 of Q8NLB7
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 43% coverage: 8:194/436 of query aligns to 40:238/572 of O42885
Sites not aligning to the query:
>BWI76_RS04280 FitnessBrowser__Koxy:BWI76_RS04280
MSHCTRPLNRQDYKTLTLAALGGALEFYDFIIFVFFAAVVGELFFPADIPEWLRQVQTFG
IFAAGYLARPLGGIIMAHFGDLVGRKKMFTLSILLMALPTLAIGLLPTYASVGIVAPLLL
LFMRILQGAAIGGEVPGAWVFVAEHVPEKRIGIACGTLTAGLTVGILLGSVVATLINTNL
TPQGIHEGGWRIPFLLGGAFGLVAMYLRRWLQETPVFLEMQQRKALAQELPVKAVALKHQ
KAVAVSMLLTWLLSAGVVVVILMSPVWLQKHYGFAPAITLQANSIATIMLCIGCLLAGLA
ADRFGASRTFIVGSVFLAAASWAFYHLSGASPQRLFLLYGTVGLCVGVVGAVPYVMVRAF
PAEVRFTGISFSYNVSYAIFGGLTPIAVTMLMGVSPMAPAWYVLALSFMGLGLGIWLRQG
LDEQVAAPKAELQRLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory