Comparing BWI76_RS04370 FitnessBrowser__Koxy:BWI76_RS04370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6p3hC Crystal structure of ligu(k66m) bound to substrate (see paper)
44% identity, 99% coverage: 1:349/351 of query aligns to 2:351/352 of 6p3hC
6p3jB Crystal structure of ligu (see paper)
44% identity, 100% coverage: 1:351/351 of query aligns to 7:350/352 of 6p3jB
Sites not aligning to the query:
Q8EJW4 2-methyl-aconitate isomerase; Cis-trans isomerase; EC 5.3.3.- from Shewanella oneidensis (strain MR-1) (see paper)
34% identity, 99% coverage: 4:351/351 of query aligns to 12:396/397 of Q8EJW4
5k87A Crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
34% identity, 99% coverage: 4:351/351 of query aligns to 8:388/389 of 5k87A
2pw0A Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
34% identity, 99% coverage: 4:351/351 of query aligns to 7:384/385 of 2pw0A
2pvzA Crystal structure of methylaconitate isomerase prpf from shewanella oneidensis (see paper)
34% identity, 99% coverage: 4:351/351 of query aligns to 8:386/387 of 2pvzA
2pw0B Crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis (see paper)
34% identity, 99% coverage: 4:351/351 of query aligns to 8:340/341 of 2pw0B
6r77A Crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation (see paper)
37% identity, 23% coverage: 61:141/351 of query aligns to 78:150/348 of 6r77A
Sites not aligning to the query:
>BWI76_RS04370 FitnessBrowser__Koxy:BWI76_RS04370
MKSIPCVLMRGGTSKGAFLLADDLPKDIQKRDDCLLAIMGSGHELEIDGIGGGSPQTSKV
AIISQSLSEEADIDYLFVQVIVNERRVDTTPNCGNMLCAVGGFAIEHGLVEAASPVTRVR
IRNVNTNTFIDADVQTPDGKVIYEGDSQIDGVPGRAAPVALTFLNAAGAKSGRLFPTGNR
MDVFDDVRVTCIDMAMPMVVIPAQSLGKTGYESASELDRDSGLLKSLESIRIQAGKAMGF
GDVTNMVIPKPVLISPALSGGSINVRYFMPHNCHKSLAITGAIGLASACIIPKTIANELT
KLSGDGIIKVEHPSGGIEVDLSQTTERPEDIRASVIRTARKILSGTVYIPE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory