Comparing BWI76_RS04375 FitnessBrowser__Koxy:BWI76_RS04375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9FMF7 Dicarboxylate transporter 2.1, chloroplastic; AtpDCT1; Glutamate/malate translocator from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 99% coverage: 2:471/477 of query aligns to 92:560/563 of Q9FMF7
6okzB Structure of vcindy bound to fumarate
26% identity, 74% coverage: 57:411/477 of query aligns to 46:388/444 of 6okzB
7t9gA Structure of vcindy-na+ (see paper)
26% identity, 74% coverage: 57:411/477 of query aligns to 47:389/445 of 7t9gA
Sites not aligning to the query:
6wtxA Structure of vcindy in complex with terephthalate (see paper)
26% identity, 74% coverage: 57:411/477 of query aligns to 47:389/445 of 6wtxA
Sites not aligning to the query:
4f35B Crystal structure of a bacterial dicarboxylate/sodium symporter (see paper)
30% identity, 27% coverage: 285:411/477 of query aligns to 229:360/414 of 4f35B
Sites not aligning to the query:
>BWI76_RS04375 FitnessBrowser__Koxy:BWI76_RS04375
MQKNKLWKLLVIIAIPLLISLFPAPEGLSKLAWVLSGIYLAAIVGLVIKPFAEPVVLLIA
VAASMVVVGNLGDGSIKAASVLSGYSSGTTWLVFSAFTLSAAFVITGLGKRIAYILIGKI
GSTTLGLGYVTAFLDLILAPATPSNTARAGGIVLPIINSVAVALGSEPERSAKRVGHYLM
LNVYMVTKTTSYMFFTAMAGNILALKMIEDICHIKLSWGGWALAAGLPGIIMLLLTPLIT
YKLYPPELKKVDNKKIAKAGMEALGPMTLREKMLSCLFVLALGGWVFSQSLGVNESTVAI
GVMALMLVLRIVTWDDVIKNKGGWNTLIWYGGIIGLSSLLSKVGFFLWLADLLKNNISFN
GHGNVAFIVIVALSILVRYFFASGSAYIVAMVPVFAMLANVSGAPVMLTALALLFSNSYG
GMVTHYGGAAGPVIFGVGYNDIKSWWIIGGILALLTFLLQITLGVWWWEILIAWKVI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory