SitesBLAST
Comparing BWI76_RS04380 FitnessBrowser__Koxy:BWI76_RS04380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6okzB Structure of vcindy bound to fumarate
31% identity, 95% coverage: 4:400/419 of query aligns to 27:427/444 of 6okzB
7t9gA Structure of vcindy-na+ (see paper)
31% identity, 95% coverage: 4:400/419 of query aligns to 28:428/445 of 7t9gA
6wtxA Structure of vcindy in complex with terephthalate (see paper)
31% identity, 95% coverage: 4:400/419 of query aligns to 28:428/445 of 6wtxA
- binding sodium ion: S129 (= S104), S133 (= S108), N134 (= N109), G176 (= G146), G182 (= G152), T356 (= T328), A359 (≠ M331), S360 (= S332), N361 (= N333), A403 (≠ G375)
- binding terephthalic acid: N134 (= N109), S183 (= S153), S360 (= S332), N361 (= N333), T362 (= T334), T404 (= T376)
4f35B Crystal structure of a bacterial dicarboxylate/sodium symporter (see paper)
31% identity, 95% coverage: 4:400/419 of query aligns to 27:397/414 of 4f35B
7jsjA Structure of the nact-pf2 complex (see paper)
23% identity, 93% coverage: 21:410/419 of query aligns to 40:448/468 of 7jsjA
- binding sodium ion: S124 (= S104), I127 (≠ L107), S128 (= S108), N129 (= N109), G172 (vs. gap), T366 (= T328), T369 (≠ M331), S370 (= S332), N371 (= N333), A413 (≠ G375), T414 (= T376)
- binding (2R)-2-[2-(4-tert-butylphenyl)ethyl]-2-hydroxybutanedioic acid: N129 (= N109), T130 (= T110), T173 (vs. gap), G315 (≠ Q275), I316 (≠ T276), N371 (= N333)
Q86YT5 Na(+)/citrate cotransporter; NaCT; Sodium-coupled citrate transporter; Sodium-dependent citrate transporter; Solute carrier family 13 member 5 from Homo sapiens (Human) (see 5 papers)
31% identity, 32% coverage: 277:410/419 of query aligns to 411:542/568 of Q86YT5
- L420 (= L286) to P: loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs150738356
- S427 (≠ T293) to L: in DEE25; loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs548065551
- L485 (≠ A353) to R: no effect on localization to plasma membrane; reduced function in citrate transport; increased Km and Vmax values compared with that of wild type with citrate as substrate; dbSNP:rs148049520
- L488 (≠ R356) to P: in DEE25; loss of function in citrate transport; loss of localization to plasma membrane; dbSNP:rs587777578
- D524 (= D392) to H: in DEE25; loss of function in citrate transport; no effect on localization to plasma membrane; dbSNP:rs863225448
Sites not aligning to the query:
- 142 T → M: in DEE25; no loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs761917087
- 219 G → E: loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs150024888; G → R: in DEE25; loss of function in citrate transport; loss of localization to plasma membrane; dbSNP:rs144332569
- 227 T → M: in DEE25; loss of function in citrate transport; no effect on localization to plasma membrane; dbSNP:rs587777577
- 243 D → N: no effect on localization to plasma membrane; no effect on its function in citrate transport; dbSNP:rs142262032
- 341:568 natural variant: Missing (in DEE25; loss of localization to plasma membrane; loss of function in citrate transport)
- 409 G→Q: No effect on its function in citrate transport.
- 410 mutation I->A,F: Significant loss of function in citrate transport.; I→V: No effect on its function in citrate transport.
- 562 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q28615 Solute carrier family 13 member 2; Na(+)/dicarboxylate cotransporter 1; NaDC-1; Renal sodium/dicarboxylate cotransporter from Oryctolagus cuniculus (Rabbit) (see paper)
31% identity, 36% coverage: 256:407/419 of query aligns to 409:553/593 of Q28615
- Y432 (≠ L284) mutation to C: Does not affect cell membrane localization. Decreases succinate transport activity. Decreases Km value for succinate. More sensitive to inhibition by lithium.
- T474 (= T328) mutation to C: Does not affect cell membrane localization. Abolishes succinate transport activity.
- N525 (= N379) mutation to C: Decreases cell membrane expression. Decreases succinate transport activity.
- M539 (≠ Y393) mutation to C: Does not affect cell membrane localization. Decreases succinate transport activity. Insensitive to inhibition by lithium.
Sites not aligning to the query:
- 83 L→C: Decreases cell membrane expression. Decreases succinate transport activity. Decreases Km value for succinate.
- 86 T→C: Does not affect cell membrane localization. Decreases succinate transport activity.
- 228 Y→C: Does not affect cell membrane localization. Decreases succinate transport activity.
Q10SY9 Silicon efflux transporter LSI2; Low silicon protein 2 from Oryza sativa subsp. japonica (Rice) (see paper)
25% identity, 37% coverage: 25:181/419 of query aligns to 295:456/472 of Q10SY9
Sites not aligning to the query:
- 115 S→N: In lsi2; impairs silicon uptake. Reduced growth. Grain discoloration. Reduces grain yield 2.5-fold.
Query Sequence
>BWI76_RS04380 FitnessBrowser__Koxy:BWI76_RS04380
MSPVTITLSLLVFSIVMFVWEKIPLAVTAMIVCITLVVTGVFDVQTAFSGFINQNVILFV
AMFVVGGALFETGVTDKIGGIVTRYARSEKQLIVIIMLVCGLLSGVLSNTGTAAVLIPVV
IGAAIKSGYARSRLLMPLAFASALGGNLSLIGSPGNLIAQSALEQVGQSFGFFEYAKLGI
PMLACGILYFVTIGYRILPGKNTLQKHGAESIRTVDCPTYKQVIALSVLIATVLGMIFEK
RIGLPIAIIGSIGALSLVMTRVITEKQAYQAIDSQTIFLFGGTLALAKALETTGAGAIMA
RSIIDLLGHQASPFLLLSAVLIISCILTNFMSNTATAALLMPIGLSIAHSMGADPRAVLM
AIVIGCSCAYATPVGTPANMMIFSAGGYKFVDYVKVGLPLILISVIVSFILLPIFFPFY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory