SitesBLAST
Comparing BWI76_RS04695 FitnessBrowser__Koxy:BWI76_RS04695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
42% identity, 98% coverage: 2:566/574 of query aligns to 92:657/667 of P09342
- C161 (≠ V71) modified: Disulfide link with 307
- P194 (≠ A104) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A217) modified: Disulfide link with 161
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 92:664/687 of P07342
- R241 (= R153) binding
- 355:376 (vs. 261:282, 50% identical) binding
- 407:426 (vs. 304:323, 30% identical) binding
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 12:584/607 of 6u9dB
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M274 (= M260), V301 (≠ T287), V417 (= V395), G443 (= G421), M445 (= M423), D470 (= D448), N497 (= N475), E499 (≠ Y477), Q500 (≠ L478), M502 (= M480), V503 (= V481), W506 (= W484)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G28), V111 (= V103), P112 (≠ A104), F121 (= F113), K171 (= K163), D299 (= D285), R300 (= R286), M502 (= M480), W506 (= W484)
- binding flavin-adenine dinucleotide: R161 (= R153), A228 (≠ G215), G229 (= G216), N232 (= N219), T254 (≠ S240), L255 (= L241), Q256 (≠ M242), L272 (= L258), M274 (= M260), G294 (= G280), R296 (= R282), D298 (= D284), R300 (= R286), V301 (≠ T287), E327 (≠ D304), V328 (≠ I305), N332 (≠ S309), D346 (= D323), A347 (= A324), M422 (= M400), G440 (= G418), G441 (= G419)
- binding magnesium ion: D470 (= D448), N497 (= N475)
- binding thiamine diphosphate: E59 (= E51), P85 (= P77), V417 (= V395), G418 (= G396), Q419 (= Q397), H420 (= H398), G443 (= G421), M445 (= M423), A471 (≠ G449), S472 (= S450), N497 (= N475), E499 (≠ Y477), Q500 (≠ L478), G501 (= G479), M502 (= M480), V503 (= V481)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
42% identity, 98% coverage: 2:566/574 of query aligns to 89:654/664 of P09114
- P191 (≠ A104) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W484) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
42% identity, 98% coverage: 4:566/574 of query aligns to 10:576/599 of 1n0hA
- active site: Y31 (= Y25), G33 (= G27), G34 (= G28), A35 (= A29), I36 (≠ V30), E57 (= E51), T80 (= T74), F119 (= F113), Q120 (= Q114), E121 (= E115), K169 (= K163), R230 (≠ Q225), M266 (= M260), V293 (≠ T287), V409 (= V395), L434 (= L420), G435 (= G421), M437 (= M423), D462 (= D448), N489 (= N475), E491 (≠ Y477), Q492 (≠ L478), M494 (= M480), V495 (= V481), W498 (= W484), L520 (≠ V507), G525 (= G512), L526 (≠ H513), K559 (≠ G549)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V395), G410 (= G396), Q411 (= Q397), H412 (= H398), G435 (= G421), M437 (= M423), G461 (= G447), D462 (= D448), A463 (≠ G449), S464 (= S450), M467 (= M453), N489 (= N475), E491 (≠ Y477), Q492 (≠ L478), G493 (= G479), V495 (= V481)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G28), A35 (= A29), V109 (= V103), P110 (≠ A104), F119 (= F113), K169 (= K163), M266 (= M260), D291 (= D285), R292 (= R286), V495 (= V481), W498 (= W484)
- binding flavin-adenine dinucleotide: R159 (= R153), G219 (= G214), A220 (≠ G215), G221 (= G216), N224 (= N219), T246 (≠ S240), L247 (= L241), Q248 (≠ M242), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), A287 (≠ V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), E319 (≠ D304), V320 (≠ I305), N324 (≠ S309), G337 (= G322), D338 (= D323), A339 (= A324), M414 (= M400), G432 (= G418), G433 (= G419)
- binding magnesium ion: D462 (= D448), N489 (= N475), E491 (≠ Y477)
- binding thiamine diphosphate: Y31 (= Y25), E57 (= E51), P83 (= P77)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:573/596 of 1t9cA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R227 (≠ Q225), M263 (= M260), V290 (≠ T287), V406 (= V395), L431 (= L420), G432 (= G421), M434 (= M423), D459 (= D448), N486 (= N475), E488 (≠ Y477), Q489 (≠ L478), M491 (= M480), V492 (= V481), W495 (= W484), L517 (≠ V507), G522 (= G512), L523 (≠ H513), K556 (≠ G549)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G28), V107 (= V103), P108 (≠ A104), F117 (= F113), K167 (= K163), D288 (= D285), R289 (= R286), W495 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (= N219), T243 (≠ S240), L244 (= L241), Q245 (≠ M242), L261 (= L258), M263 (= M260), H264 (= H261), G283 (= G280), A284 (≠ V281), R285 (= R282), D287 (= D284), R289 (= R286), V290 (≠ T287), E316 (≠ D304), V317 (≠ I305), N321 (≠ S309), G334 (= G322), D335 (= D323), A336 (= A324), M411 (= M400), G429 (= G418), G430 (= G419)
- binding magnesium ion: D459 (= D448), N486 (= N475), E488 (≠ Y477)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:572/595 of 1t9bB
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R226 (≠ Q225), M262 (= M260), V289 (≠ T287), V405 (= V395), L430 (= L420), G431 (= G421), M433 (= M423), D458 (= D448), N485 (= N475), E487 (≠ Y477), Q488 (≠ L478), M490 (= M480), V491 (= V481), W494 (= W484), L516 (≠ V507), G521 (= G512), L522 (≠ H513), K555 (≠ G549)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V103), P108 (≠ A104), D287 (= D285), R288 (= R286), M490 (= M480), W494 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G215 (= G214), A216 (≠ G215), G217 (= G216), N220 (= N219), T242 (≠ S240), L243 (= L241), Q244 (≠ M242), M259 (= M257), L260 (= L258), M262 (= M260), H263 (= H261), G282 (= G280), A283 (≠ V281), R284 (= R282), D286 (= D284), R288 (= R286), V289 (≠ T287), E315 (≠ D304), V316 (≠ I305), N320 (≠ S309), G333 (= G322), D334 (= D323), A335 (= A324), Q409 (= Q399), M410 (= M400), G428 (= G418), G429 (= G419)
- binding magnesium ion: D458 (= D448), N485 (= N475), E487 (≠ Y477)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
42% identity, 98% coverage: 4:566/574 of query aligns to 8:573/596 of 1t9dA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R227 (≠ Q225), M263 (= M260), V290 (≠ T287), V406 (= V395), L431 (= L420), G432 (= G421), M434 (= M423), D459 (= D448), N486 (= N475), E488 (≠ Y477), Q489 (≠ L478), M491 (= M480), V492 (= V481), W495 (= W484), L517 (≠ V507), G522 (= G512), L523 (≠ H513), K556 (≠ G549)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G28), A33 (= A29), V107 (= V103), P108 (≠ A104), F117 (= F113), K167 (= K163), M263 (= M260), D288 (= D285), R289 (= R286), W495 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (= N219), T243 (≠ S240), L244 (= L241), Q245 (≠ M242), M260 (= M257), L261 (= L258), H264 (= H261), G283 (= G280), A284 (≠ V281), R285 (= R282), D287 (= D284), R289 (= R286), V290 (≠ T287), E316 (≠ D304), V317 (≠ I305), N321 (≠ S309), G334 (= G322), D335 (= D323), A336 (= A324), Q410 (= Q399), M411 (= M400), G429 (= G418), G430 (= G419)
- binding magnesium ion: D459 (= D448), N486 (= N475), E488 (≠ Y477)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E51), P81 (= P77), Q118 (= Q114), G432 (= G421), M434 (= M423), M464 (= M453)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
42% identity, 98% coverage: 4:566/574 of query aligns to 9:574/597 of 1t9aA
- active site: Y30 (= Y25), G32 (= G27), G33 (= G28), A34 (= A29), I35 (≠ V30), E56 (= E51), T79 (= T74), F118 (= F113), Q119 (= Q114), E120 (= E115), K168 (= K163), R228 (≠ Q225), M264 (= M260), V291 (≠ T287), V407 (= V395), L432 (= L420), G433 (= G421), M435 (= M423), D460 (= D448), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), M492 (= M480), V493 (= V481), W496 (= W484), L518 (≠ V507), G523 (= G512), L524 (≠ H513), K557 (≠ G549)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G28), V108 (= V103), P109 (≠ A104), F118 (= F113), K168 (= K163), M264 (= M260), D289 (= D285), R290 (= R286), M492 (= M480), V493 (= V481), W496 (= W484)
- binding flavin-adenine dinucleotide: R158 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (= N219), T244 (≠ S240), L245 (= L241), Q246 (≠ M242), L262 (= L258), M264 (= M260), H265 (= H261), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), V318 (≠ I305), N322 (≠ S309), G335 (= G322), D336 (= D323), A337 (= A324), Q411 (= Q399), M412 (= M400), G430 (= G418), G431 (= G419)
- binding magnesium ion: D460 (= D448), N487 (= N475), E489 (≠ Y477)
- binding propyl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G421), M435 (= M423), M465 (= M453)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:560/583 of 1t9bA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R214 (≠ Q225), M250 (= M260), V277 (≠ T287), V393 (= V395), L418 (= L420), G419 (= G421), M421 (= M423), D446 (= D448), N473 (= N475), E475 (≠ Y477), Q476 (≠ L478), M478 (= M480), V479 (= V481), W482 (= W484), L504 (≠ V507), G509 (= G512), L510 (≠ H513), K543 (≠ G549)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V103), P108 (≠ A104), F117 (= F113), D275 (= D285), R276 (= R286), M478 (= M480), W482 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G203 (= G214), A204 (≠ G215), G205 (= G216), N208 (= N219), T230 (≠ S240), L231 (= L241), Q232 (≠ M242), M247 (= M257), L248 (= L258), M250 (= M260), H251 (= H261), G270 (= G280), A271 (≠ V281), R272 (= R282), D274 (= D284), R276 (= R286), V277 (≠ T287), E303 (≠ D304), V304 (≠ I305), N308 (≠ S309), D322 (= D323), A323 (= A324), Q397 (= Q399), M398 (= M400), G416 (= G418), G417 (= G419)
- binding magnesium ion: D446 (= D448), N473 (= N475), E475 (≠ Y477)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 7:559/582 of 1t9dB
- active site: Y28 (= Y25), G30 (= G27), G31 (= G28), A32 (= A29), I33 (≠ V30), E54 (= E51), T77 (= T74), F116 (= F113), Q117 (= Q114), E118 (= E115), K166 (= K163), R213 (≠ Q225), M249 (= M260), V276 (≠ T287), V392 (= V395), L417 (= L420), G418 (= G421), M420 (= M423), D445 (= D448), N472 (= N475), E474 (≠ Y477), Q475 (≠ L478), M477 (= M480), V478 (= V481), W481 (= W484), L503 (≠ V507), G508 (= G512), L509 (≠ H513), K542 (≠ G549)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G28), A32 (= A29), V106 (= V103), P107 (≠ A104), F116 (= F113), K166 (= K163), M249 (= M260), D274 (= D285), R275 (= R286), W481 (= W484)
- binding flavin-adenine dinucleotide: R156 (= R153), G202 (= G214), A203 (≠ G215), G204 (= G216), N207 (= N219), T229 (≠ S240), L230 (= L241), Q231 (≠ M242), L247 (= L258), M249 (= M260), H250 (= H261), G269 (= G280), A270 (≠ V281), R271 (= R282), D273 (= D284), R275 (= R286), V276 (≠ T287), E302 (≠ D304), V303 (≠ I305), N307 (≠ S309), G320 (= G322), D321 (= D323), A322 (= A324), Q396 (= Q399), M397 (= M400), G415 (= G418), G416 (= G419)
- binding magnesium ion: D445 (= D448), N472 (= N475), E474 (≠ Y477)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E51), P80 (= P77), G418 (= G421), M420 (= M423), M450 (= M453)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
42% identity, 98% coverage: 4:566/574 of query aligns to 8:568/591 of 5wkcA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R222 (≠ Q225), M258 (= M260), V285 (≠ T287), V401 (= V395), L426 (= L420), G427 (= G421), M429 (= M423), D454 (= D448), N481 (= N475), E483 (≠ Y477), Q484 (≠ L478), M486 (= M480), V487 (= V481), W490 (= W484), L512 (≠ V507), G517 (= G512), L518 (≠ H513), K551 (≠ G549)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V395), G402 (= G396), Q403 (= Q397), H404 (= H398), G427 (= G421), M429 (= M423), G453 (= G447), D454 (= D448), A455 (≠ G449), S456 (= S450), M459 (= M453), N481 (= N475), E483 (≠ Y477), Q484 (≠ L478), G485 (= G479), M486 (= M480), V487 (= V481)
- binding ethaneperoxoic acid: G32 (= G28), Q118 (= Q114)
- binding flavin-adenine dinucleotide: R157 (= R153), G211 (= G214), A212 (≠ G215), G213 (= G216), N216 (= N219), T238 (≠ S240), L239 (= L241), Q240 (≠ M242), L256 (= L258), M258 (= M260), G278 (= G280), A279 (≠ V281), R280 (= R282), R284 (= R286), V285 (≠ T287), E311 (≠ D304), V312 (≠ I305), N316 (≠ S309), D330 (= D323), A331 (= A324), M406 (= M400), G424 (= G418)
- binding magnesium ion: D454 (= D448), N481 (= N475), E483 (≠ Y477)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G28), A33 (= A29), V107 (= V103), F117 (= F113), K167 (= K163), M258 (= M260), R284 (= R286), M486 (= M480), W490 (= W484)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P26), E55 (= E51)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
42% identity, 98% coverage: 6:566/574 of query aligns to 99:660/670 of P17597
- A122 (= A29) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L31) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E51) binding
- S186 (= S93) binding
- P197 (≠ A104) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S106) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q114) binding
- K220 (= K127) binding
- R246 (= R153) binding ; binding
- K256 (= K163) binding
- G308 (= G215) binding
- TL 331:332 (≠ SL 240:241) binding
- C340 (≠ A249) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 258:261) binding
- GVRFD 371:375 (= GVRFD 280:284) binding
- DR 376:377 (= DR 285:286) binding
- DI 395:396 (= DI 304:305) binding
- DV 414:415 (≠ DA 323:324) binding
- QH 487:488 (= QH 397:398) binding
- GG 508:509 (= GG 418:419) binding
- GAM 511:513 (≠ GTM 421:423) binding
- D538 (= D448) binding
- DGS 538:540 (= DGS 448:450) binding
- N565 (= N475) binding
- NQHLGM 565:570 (≠ NRYLGM 475:480) binding
- H567 (≠ Y477) binding
- W574 (= W484) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ R559) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
42% identity, 99% coverage: 4:573/574 of query aligns to 14:587/601 of 6deqA
- active site: Y35 (= Y25), G37 (= G27), G38 (= G28), A39 (= A29), I40 (≠ V30), E61 (= E51), T84 (= T74), F123 (= F113), Q124 (= Q114), E125 (= E115), K173 (= K163), K232 (≠ Q225), M268 (= M260), V295 (≠ T287), V411 (= V395), L436 (= L420), G437 (= G421), M439 (= M423), D464 (= D448), N491 (= N475), E493 (≠ Y477), Q494 (≠ L478), M496 (= M480), V497 (= V481), W500 (= W484), L522 (≠ V507), N527 (≠ G512), V528 (≠ H513)
- binding flavin-adenine dinucleotide: R163 (= R153), G221 (= G214), A222 (≠ G215), G223 (= G216), N226 (= N219), T248 (≠ S240), L249 (= L241), Q250 (≠ M242), L266 (= L258), G288 (= G280), A289 (≠ V281), R290 (= R282), D292 (= D284), R294 (= R286), V295 (≠ T287), E321 (≠ D304), I322 (= I305), D340 (= D323), V341 (≠ A324), M416 (= M400), G434 (= G418)
- binding magnesium ion: D464 (= D448), N491 (= N475), E493 (≠ Y477)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M260), R294 (= R286), M496 (= M480), V497 (= V481), W500 (= W484), A571 (≠ R559)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V395), G412 (= G396), Q413 (= Q397), H414 (= H398), M439 (= M423), G463 (= G447), D464 (= D448), A465 (≠ G449), S466 (= S450), N491 (= N475), E493 (≠ Y477), Q494 (≠ L478), G495 (= G479), M496 (= M480), V497 (= V481)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
42% identity, 99% coverage: 4:573/574 of query aligns to 12:583/597 of 6demA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), K228 (≠ Q225), M264 (= M260), V291 (≠ T287), V407 (= V395), L432 (= L420), G433 (= G421), M435 (= M423), D460 (= D448), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), M492 (= M480), V493 (= V481), W496 (= W484), L518 (≠ V507), N523 (≠ G512), V524 (≠ H513)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M260), D289 (= D285), R290 (= R286), M492 (= M480), W496 (= W484), A567 (≠ R559)
- binding flavin-adenine dinucleotide: R161 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (= N219), T244 (≠ S240), L245 (= L241), Q246 (≠ M242), L262 (= L258), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), I318 (= I305), N322 (≠ S309), D336 (= D323), V337 (≠ A324), M412 (= M400), G430 (= G418)
- binding magnesium ion: D460 (= D448), N487 (= N475), E489 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), M465 (= M453), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480), V493 (= V481)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
42% identity, 99% coverage: 4:573/574 of query aligns to 12:583/597 of 6delA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), K228 (≠ Q225), M264 (= M260), V291 (≠ T287), V407 (= V395), L432 (= L420), G433 (= G421), M435 (= M423), D460 (= D448), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), M492 (= M480), V493 (= V481), W496 (= W484), L518 (≠ V507), N523 (≠ G512), V524 (≠ H513)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D285), R290 (= R286), W496 (= W484)
- binding flavin-adenine dinucleotide: R161 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (= N219), T244 (≠ S240), L245 (= L241), Q246 (≠ M242), L262 (= L258), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), I318 (= I305), N322 (≠ S309), D336 (= D323), V337 (≠ A324), M412 (= M400), G430 (= G418)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), G433 (= G421), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), M465 (= M453), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480), V493 (= V481)
- binding magnesium ion: D460 (= D448), N487 (= N475), E489 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), G433 (= G421), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), M465 (= M453), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480), V493 (= V481)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
42% identity, 98% coverage: 6:566/574 of query aligns to 14:575/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M260), R292 (= R286), W489 (= W484), S568 (≠ R559)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V395), G401 (= G396), Q402 (= Q397), H403 (= H398), G426 (= G421), M428 (= M423), G452 (= G447), D453 (= D448), G454 (= G449), S455 (= S450), L483 (= L478), G484 (= G479), M485 (= M480), V486 (= V481)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S240), L247 (= L241), M248 (= M242), M263 (= M257), L264 (= L258), M266 (= M260), H267 (= H261), G286 (= G280), R288 (= R282), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (= D323), V330 (≠ A324), M405 (= M400), G423 (= G418)
- binding magnesium ion: A37 (= A29), T82 (= T74), S83 (= S75), Q122 (= Q114), Y381 (≠ A376), D453 (= D448), M458 (= M453), Q461 (= Q456), N480 (= N475), H482 (≠ Y477), K533 (≠ E525)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
42% identity, 98% coverage: 6:566/574 of query aligns to 14:575/585 of 5k2oA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V395), G426 (= G421), M428 (= M423), D453 (= D448), N480 (= N475), H482 (≠ Y477), L483 (= L478), M485 (= M480), V486 (= V481), W489 (= W484), H558 (≠ G549)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M260), R292 (= R286), W489 (= W484), S568 (≠ R559)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S240), L247 (= L241), M248 (= M242), L264 (= L258), G286 (= G280), R288 (= R282), D290 (= D284), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (= D323), V330 (≠ A324), Q404 (= Q399), M405 (= M400), G423 (= G418)
- binding magnesium ion: D453 (= D448), N480 (= N475), H482 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V395), G401 (= G396), Q402 (= Q397), H403 (= H398), M428 (= M423), D453 (= D448), G454 (= G449), S455 (= S450), N480 (= N475), H482 (≠ Y477), L483 (= L478), G484 (= G479), M485 (= M480), V486 (= V481)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
42% identity, 98% coverage: 6:566/574 of query aligns to 14:575/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V395), G401 (= G396), Q402 (= Q397), H403 (= H398), G426 (= G421), M428 (= M423), G452 (= G447), D453 (= D448), G454 (= G449), S455 (= S450), M458 (= M453), N480 (= N475), H482 (≠ Y477), L483 (= L478), G484 (= G479), M485 (= M480), V486 (= V481)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S240), L247 (= L241), M248 (= M242), L264 (= L258), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (= D323), V330 (≠ A324), M405 (= M400), G423 (= G418)
- binding magnesium ion: F370 (≠ Y365), D453 (= D448), M458 (= M453), Q461 (= Q456), N480 (= N475), H482 (≠ Y477), K533 (≠ E525)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M260), R292 (= R286), M485 (= M480), W489 (= W484), S568 (≠ R559)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
42% identity, 98% coverage: 6:566/574 of query aligns to 14:575/582 of 5wj1A
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V395), G426 (= G421), M428 (= M423), D453 (= D448), N480 (= N475), H482 (≠ Y477), L483 (= L478), M485 (= M480), V486 (= V481), W489 (= W484), H558 (≠ G549)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (≠ S240), L247 (= L241), M248 (= M242), M263 (= M257), L264 (= L258), G286 (= G280), R288 (= R282), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (= D323), V330 (≠ A324), M405 (= M400), G423 (= G418), G424 (= G419)
- binding magnesium ion: D453 (= D448), N480 (= N475), H482 (≠ Y477)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M260), D291 (= D285), R292 (= R286), M485 (= M480), W489 (= W484), S568 (≠ R559)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V395), G401 (= G396), Q402 (= Q397), H403 (= H398), M428 (= M423), D453 (= D448), G454 (= G449), S455 (= S450), M458 (= M453), N480 (= N475), H482 (≠ Y477), L483 (= L478), G484 (= G479), M485 (= M480), V486 (= V481)
Query Sequence
>BWI76_RS04695 FitnessBrowser__Koxy:BWI76_RS04695
MEMLSGAEMVVQSLVDQGVKQVFGYPGGAVLDIYDALHTLGGIDHVLVRHEQAAVHMADG
LARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVG
ISRPVVKHSFLVKQTEDIPGVLKKAFWLAASGRPGPVVVDLPKDILNPAKKLPYVWPDTV
SMRSYNPTTSGHKGQIKRALQTLVAAKKPVVYVGGGAINAQCEPQLYTLVEKLKLPVASS
LMGLGAFPASHQQALGMLGMHGTYEANMTMHNSDVIFAVGVRFDDRTTNNLARYCPNATV
LHIDIDPTSISKTVPADVPIVGDARLVLEQMLELLEHEETQQPLDEIRDWWQQIEQWRAR
HCLQYDTQSGKIKPQAVIETIWRLTHGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGL
GTMGFGLPAALGVKMALPEETVICVTGDGSIQMNIQELSTALQYELPVLVLNLNNRYLGM
VKQWQDMLYSGRHSQSYMESLPDFARVAEAYGHVGIRISDPQELEAKLAEALEQVRNNRL
VFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory