Comparing BWI76_RS05130 FitnessBrowser__Koxy:BWI76_RS05130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
92% identity, 100% coverage: 1:265/265 of query aligns to 1:265/265 of P07821
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 79% coverage: 27:236/265 of query aligns to 21:229/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 80% coverage: 19:231/265 of query aligns to 12:225/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 82% coverage: 19:236/265 of query aligns to 12:230/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 82% coverage: 19:236/265 of query aligns to 12:230/344 of 3tuiC
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
35% identity, 89% coverage: 8:244/265 of query aligns to 2:237/278 of 8bmpA
5d3mA Folate ecf transporter: amppnp bound state (see paper)
34% identity, 89% coverage: 8:244/265 of query aligns to 2:240/280 of 5d3mA
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
34% identity, 89% coverage: 8:244/265 of query aligns to 1:237/278 of 8bmsA
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
34% identity, 86% coverage: 21:247/265 of query aligns to 9:231/248 of 4fi3C
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
34% identity, 86% coverage: 21:247/265 of query aligns to 9:231/231 of 1l7vC
O06967 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA; EC 7.6.2.- from Bacillus subtilis (strain 168) (see 2 papers)
32% identity, 90% coverage: 3:241/265 of query aligns to 332:569/589 of O06967
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
32% identity, 86% coverage: 13:239/265 of query aligns to 6:223/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
32% identity, 86% coverage: 13:239/265 of query aligns to 5:219/247 of 4zirB
4myhB Structure of the glutathione bound mitochondrial abc transporter, atm1 (see paper)
30% identity, 88% coverage: 3:236/265 of query aligns to 333:563/598 of 4myhB
Sites not aligning to the query:
7psnA S. Cerevisiae atm1 in msp1e3d1 nanodiscs with bound amp-pnp and mg2+ (see paper)
30% identity, 88% coverage: 3:236/265 of query aligns to 339:569/585 of 7psnA
Sites not aligning to the query:
7psmA S. Cerevisiae atm1 in msp1d1 nanodiscs with bound amp-pnp and mg2+ (see paper)
30% identity, 88% coverage: 3:236/265 of query aligns to 339:569/585 of 7psmA
Sites not aligning to the query:
7pslA S. Cerevisiae atm1 in msp1d1 nanodiscs in nucleotide-free state (see paper)
30% identity, 88% coverage: 3:236/265 of query aligns to 339:569/600 of 7pslA
Sites not aligning to the query:
P40416 Iron-sulfur clusters transporter ATM1, mitochondrial; EC 7.-.-.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
30% identity, 88% coverage: 3:236/265 of query aligns to 430:660/690 of P40416
Sites not aligning to the query:
7ow8A Cryoem structure of the abc transporter bmra e504a mutant in complex with atp-mg (see paper)
31% identity, 90% coverage: 3:241/265 of query aligns to 323:560/577 of 7ow8A
Sites not aligning to the query:
7bg4A Multidrug resistance transporter bmra mutant e504a bound with atp, mg, and rhodamine 6g solved by cryo-em (see paper)
31% identity, 90% coverage: 3:241/265 of query aligns to 315:552/572 of 7bg4A
Sites not aligning to the query:
>BWI76_RS05130 FitnessBrowser__Koxy:BWI76_RS05130
MQENIPHSDTTFSLDRVTFRVPGRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRH
QPPSDGDILLDGQPLDSWGSKAFARKVAYLPQQLPPAEGMTVRELVAIGRYPWHGALGRF
GAADREKVEEAIALVGLKPLAQRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDI
AHQVDVLALVHRLSQQRGLTVIAVLHDINMAARYCDYLVALRGGEMIAQGTPAALMRSET
LEQIYGIPMGILPHPAGAAPVSFVY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory