Comparing BWI76_RS05560 FitnessBrowser__Koxy:BWI76_RS05560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
36% identity, 63% coverage: 58:163/168 of query aligns to 140:243/261 of 6wyeA
Sites not aligning to the query:
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
36% identity, 63% coverage: 58:163/168 of query aligns to 138:241/243 of 7ra4A
Sites not aligning to the query:
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
32% identity, 79% coverage: 33:165/168 of query aligns to 113:243/243 of 4n69A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
31% identity, 79% coverage: 33:165/168 of query aligns to 106:233/233 of 4n6bA
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
30% identity, 65% coverage: 59:168/168 of query aligns to 136:243/257 of 1ssqD
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
36% identity, 63% coverage: 61:165/168 of query aligns to 61:181/186 of 4isxA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
33% identity, 63% coverage: 61:165/168 of query aligns to 63:181/190 of 5u2kA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
31% identity, 64% coverage: 59:165/168 of query aligns to 136:240/258 of 8i04A
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
31% identity, 64% coverage: 59:165/168 of query aligns to 139:243/246 of 8i09A
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
32% identity, 64% coverage: 59:165/168 of query aligns to 140:244/262 of 1t3dA
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
31% identity, 64% coverage: 59:165/168 of query aligns to 140:244/244 of 8i06A
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
32% identity, 64% coverage: 59:165/168 of query aligns to 143:247/272 of 3gvdI
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 57% coverage: 70:165/168 of query aligns to 85:182/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
34% identity, 57% coverage: 70:165/168 of query aligns to 84:181/200 of 1krrA
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
34% identity, 57% coverage: 70:165/168 of query aligns to 84:181/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
34% identity, 57% coverage: 70:165/168 of query aligns to 84:181/201 of 1kruA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
30% identity, 66% coverage: 55:165/168 of query aligns to 136:244/250 of 4hzdA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
27% identity, 90% coverage: 15:165/168 of query aligns to 82:240/258 of 4h7oA
Sites not aligning to the query:
4aawA S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
41% identity, 49% coverage: 87:168/168 of query aligns to 360:442/455 of 4aawA
Sites not aligning to the query:
7kr9A Bifunctional enzyme glmu bound to zn(ii) (see paper)
41% identity, 49% coverage: 87:168/168 of query aligns to 358:440/453 of 7kr9A
Sites not aligning to the query:
>BWI76_RS05560 FitnessBrowser__Koxy:BWI76_RS05560
MFEAIRQVGQEIKSCGGIKAKIAVLLYRLATLYRSRNPLWKICGIPFVILNIVINECLFC
IELPWRARIGYGLKLYHPHCIVINRGTIIGQNCTLRQGVTIGSVTDSQGRESASPRIGDN
VEFGAHAVVIGAVTLGDNVKVGAGTVVTKDLAAGMIAVGQPYRVLNGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory