Comparing BWI76_RS05685 FitnessBrowser__Koxy:BWI76_RS05685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
26% identity, 96% coverage: 6:303/309 of query aligns to 2:288/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
26% identity, 96% coverage: 6:303/309 of query aligns to 2:288/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
26% identity, 96% coverage: 6:303/309 of query aligns to 2:288/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
26% identity, 96% coverage: 6:303/309 of query aligns to 2:288/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
26% identity, 96% coverage: 6:303/309 of query aligns to 2:288/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
26% identity, 96% coverage: 6:303/309 of query aligns to 2:288/291 of 3pueB
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
25% identity, 97% coverage: 6:305/309 of query aligns to 3:294/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
25% identity, 97% coverage: 6:305/309 of query aligns to 2:293/294 of Q9X1K9
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 96% coverage: 6:303/309 of query aligns to 2:288/292 of Q07607
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
29% identity, 97% coverage: 6:305/309 of query aligns to 2:292/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
28% identity, 97% coverage: 6:305/309 of query aligns to 2:292/294 of Q8UGL3
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
25% identity, 92% coverage: 6:289/309 of query aligns to 3:281/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
25% identity, 92% coverage: 6:289/309 of query aligns to 3:281/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
25% identity, 92% coverage: 6:289/309 of query aligns to 3:281/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
25% identity, 92% coverage: 6:289/309 of query aligns to 3:281/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
25% identity, 92% coverage: 6:289/309 of query aligns to 3:281/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
25% identity, 92% coverage: 6:289/309 of query aligns to 3:281/298 of 3nevA
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
25% identity, 94% coverage: 6:296/309 of query aligns to 6:286/297 of 8u8wA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
28% identity, 94% coverage: 12:301/309 of query aligns to 8:286/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
28% identity, 94% coverage: 12:301/309 of query aligns to 8:286/292 of 3puoA
>BWI76_RS05685 FitnessBrowser__Koxy:BWI76_RS05685
MINIDLRGLTPAPVTPFTRDGRVDYDAIQRLGNWLGSIDGVKGLVVLGHAGEGTFLTQEE
QANVIRAFVKSVDDKLPIIAGITGEGTEVAALEAKRAVAAGASAGLLYPSHGWLRFGYQD
GAPQDRYRVVYEESGLPLILFQYPDVTKATYNLKTLLDISAQPGVFAMKNGVRNMRRWDT
EIPVIRRERPDLQILSCHDEYLLHTAFDVDGFLVGYGNIAPEPLIEMIKAGKAGDYVKAR
QLHDRLLPVTKSVYHRGSHMEGTVALKHALVARGILEHATVRSPLLPLENGAEKEIHDAM
RAAELGRVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory