Comparing BWI76_RS05840 FitnessBrowser__Koxy:BWI76_RS05840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
95% identity, 100% coverage: 1:367/367 of query aligns to 1:367/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
95% identity, 99% coverage: 3:367/367 of query aligns to 1:365/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
84% identity, 99% coverage: 3:367/367 of query aligns to 1:325/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
84% identity, 99% coverage: 3:367/367 of query aligns to 1:323/323 of 2j5vA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 68% coverage: 7:255/367 of query aligns to 15:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 68% coverage: 7:255/367 of query aligns to 15:234/236 of 7f5xA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 63% coverage: 7:236/367 of query aligns to 3:219/241 of 2akoA
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
26% identity, 59% coverage: 4:220/367 of query aligns to 2:221/261 of 7lnuB
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
26% identity, 59% coverage: 4:220/367 of query aligns to 1:220/260 of 7lntB
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
34% identity, 23% coverage: 149:233/367 of query aligns to 120:201/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
34% identity, 23% coverage: 149:233/367 of query aligns to 121:202/226 of 2bmuB
Sites not aligning to the query:
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
26% identity, 59% coverage: 5:220/367 of query aligns to 1:217/253 of 7n9dA
>BWI76_RS05840 FitnessBrowser__Koxy:BWI76_RS05840
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
NNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSRPG
VIGDVMEGVSVGTRFHAQESPLENRKRWIFGAPPAGEITVDAGATQAILERGSSLLPKGI
KTITGNFSRGEVIRIRSLEGRDIAHGVSRYNSDALRRIAGQHSQQIDAILGYEYGPVAVH
RDDMIIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory